KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_1605Help
Entry
Rleg2_1605        CDS       T00779                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00010  Glycolysis / Gluconeogenesis
rlt00020  Citrate cycle (TCA cycle)
rlt00620  Pyruvate metabolism
rlt01100  Metabolic pathways
rlt01110  Biosynthesis of secondary metabolites
rlt01120  Microbial metabolism in diverse environments
rlt01130  Biosynthesis of antibiotics
rlt01200  Carbon metabolism
Module
rlt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg2_1605
   00020 Citrate cycle (TCA cycle)
    Rleg2_1605
   00620 Pyruvate metabolism
    Rleg2_1605
Enzymes [BR:rlt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rleg2_1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ACI54895
UniProt: B5ZNA5
LinkDB All DBs
Position
1632579..1633919
Genome map
AA seq 446 aa AA seqDB search
MPINITMPALSPTMEEGNLSKWLVKEGDTVKSGDVIAEIETDKATMEVEAVDEGTVAKLV
VAAGTEGVKVNALIAVLAADGEDVAAAASGAGSAAPAKAEAAPAPKAEAAPAPAAAPAPA
AAPAAVSSNGNRSFSSPLARRLAKEAGIDLSAVAGSGPHGRVIKSDVEAAVAGGGAKPAA
APAAAAPQAAAAPAPAAAPKGASEDAVLKLFEPGSYELVPHDGMRKTIARRLVESKQTIP
HFYVSVDCELDALMALRAQLNDAAPRKDNAPAYKLSVNDMVIKAMALALRDVPDANVSWT
DTNMVKHKHADVGVAVSIPGGLITPIIRKAEQKTLSVISNEMRDLGKRAKDRKLKPEEYQ
GGTSSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKNGEMAIATVMSVTLSTDHR
CVDGALGAELLQAFKGYIENPMGMLV
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatatcacgatgcccgccctctctccgaccatggaagaaggcaatctttcc
aaatggctggtcaaggaaggcgatacggtcaagtctggcgacgtgatcgccgagatcgag
accgacaaggcgacgatggaagtcgaagccgtcgatgaaggcacagtcgccaagctcgtc
gttgccgccggcaccgaaggtgtcaaggtcaacgcgctgatcgccgttctcgccgccgat
ggcgaagatgtcgccgctgccgcaagcggtgcgggctccgccgctccggcgaaggccgag
gccgcacccgcaccgaaggccgaggctgcacctgctccggcagcagcgccggcgcctgcc
gccgcacctgcggcggtttcatcaaacggcaaccgcagcttctcttcgccgcttgctcgc
aggctcgccaaggaagctggtatcgatctttcggctgtcgccggctccggaccgcacggc
cgcgtcatcaagagcgacgtcgaagccgccgttgccggtggtggcgccaaacctgccgcc
gcgccggccgctgccgccccgcaggccgccgccgctccggctccggccgcagcgccgaag
ggcgcttccgaggacgccgtgctcaagctcttcgagccgggctcctacgagctcgtgccg
catgacggcatgcgcaagacgattgcccggcgcctggtcgaatccaagcagacgatcccg
catttctatgtcagcgtcgattgcgaactcgatgcgctgatggcgctgcgcgcccagctg
aacgacgccgccccccgcaaggacaatgctccggcctacaagctctcggtcaacgacatg
gtcatcaaggccatggcgctggcgctgcgcgacgtgccggatgccaacgtctcatggacc
gacaccaacatggtcaagcacaagcatgccgatgtcggcgtcgccgtctcgatccccggc
ggcctgatcaccccgatcatccgcaaggccgagcagaagacgctgtccgtcatctccaac
gagatgcgcgatctcggcaagcgggccaaggaccggaagctgaagcccgaggaatatcag
ggcggcaccagctcggtttcgaacatgggcatgatgggcgtcaagaacttcgccgccgtc
gtcaacccgccgcatgcgacgatcctcgcagtcggcgccggcgaacagcgggtcgtcgtc
aagaacggcgaaatggcgatcgccaccgtgatgtcggtcacgctgtcgaccgaccatcgc
tgcgtcgacggcgcgctcggcgccgagctgctccaggccttcaagggctacatcgagaac
ccgatgggcatgcttgtctga

DBGET integrated database retrieval system