KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_1908Help
Entry
Rleg2_1908        CDS       T00779                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00500  Starch and sucrose metabolism
rlt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rleg2_1908
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Rleg2_1908
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Rleg2_1908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ACI55193
UniProt: B5ZQR5
LinkDB All DBs
Position
1952174..1953835
Genome map
AA seq 553 aa AA seqDB search
MINDLWYKNAVIYCLSVETFMDANGDGVGDFQGLMRRLDYLSGLGVTAIWLMPFQTSPGR
DDGYDVSDYYNVDPRYGSLGDFVEFTHGAKQRGIRVLIDLVINHTSKDHPWFQGARSDPH
SPYRDWYVWSEKKPANADQGMVFPGVQKTTWTHDEKARAYYFHRFYDHQPDLNTSNPEVQ
AEILKIMGFWIQLGVSGFRMDAAPFIIATKGADVSKPVEQFDMLRKFREFLQWRLGDSII
LAEANILPKDNFEYFGNDGDRMQMMFNFQVNQALFYALASADTRPLKKAMETTKPRPATA
QWGLFLRNHDELDLGRLSEKQRGAVFAAFGPEKDMQLYDRGIRRRLAPMLGGDRRRIEMA
YSLLFSLPGTPVIRYGDEIGMGDDLTLPERNCARTPMQWSTEPEGGFTKSRKPVSPVIKD
GPYGFQHVNVAEQRRDPNSLLNWTERMIRMRKEAPEIGWGDFAVVDTGDDGVLALRYDWR
GNSVLILHNLHGQPSEVTFDPDVGEDGRQLIDIADGASSEADEKGFHTVRLDAYGYRWYR
VGGLDYLLRRREI
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgacctctggtataagaacgccgtcatctactgcctctcggtcgagaccttc
atggatgcgaacggtgacggcgtcggtgattttcaggggctgatgcggcgcctcgattat
ctctccggccttggcgtgacggcgatctggttgatgcccttccagacgtcgcccggccgc
gacgacggctatgatgtttccgactattacaatgtcgacccgcgctatggttcgctcggc
gatttcgtcgagttcacccatggcgccaagcagcgcggtatccgcgtgctgatcgacctg
gtgatcaaccacacctccaaggaccatccctggtttcaaggcgccagaagcgacccgcac
tcaccctatcgcgactggtacgtctggtctgagaaaaaacctgcgaatgccgatcagggc
atggtcttccctggcgtccagaagaccacctggacccatgacgaaaaggccagggcctat
tattttcaccgcttctacgaccaccagcccgatctcaacacctccaatcccgaggtgcag
gccgagatcctcaagatcatgggcttctggatccagctcggcgtctccggcttccggatg
gatgccgcccccttcatcatcgcgacgaaaggcgcagacgtttccaagcccgtcgagcag
ttcgacatgctgaggaagtttcgcgaattcctgcaatggcgcctgggcgattccattatc
ctcgccgaggccaatatcctgccgaaggacaattttgaatatttcggcaacgacggcgac
cgcatgcagatgatgttcaatttccaggtcaatcaggcgctgttttatgctctcgccagc
gccgatacgcggccgctgaagaaggcgatggagacgacgaaaccgcgcccggccaccgcc
caatggggtctttttctgcgcaatcacgacgaactggatctcggccggctgtcggaaaag
cagcgcggcgcggtctttgccgccttcggacccgaaaaggacatgcagctttacgacagg
ggcattcgccgtcggctggcgccgatgctcggcggcgaccgccgcaggatcgagatggct
tacagcctgctgttctcgctgcccggaacgcctgtcatccgctacggcgacgagatcggc
atgggcgacgatctgactttgccggagcgcaactgcgcccgcacgccgatgcagtggtcg
acggaaccggaaggcggtttcaccaagagtagaaagcctgtttcgcctgtaatcaaggac
ggcccctacggtttccagcatgtcaacgtcgccgagcagcggcgcgatcccaattcgctg
ctgaactggaccgaacggatgatccggatgcgcaaggaagctccggaaatcggctggggc
gacttcgctgttgtcgataccggggacgacggggtgctggcgcttcgttacgactggcgc
ggcaattccgtgttgatcctgcacaatctgcatgggcagccgtcagaagtgaccttcgat
cccgatgtcggcgaagacgggcggcagctgatcgacatcgccgatggcgccagcagcgag
gcggacgagaaaggctttcataccgtcaggctcgatgcctacggctaccgctggtatcgc
gtcggaggcctagactatctcctcaggcgcagagaaatttaa

DBGET integrated database retrieval system