KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_2755Help
Entry
Rleg2_2755        CDS       T00779                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00330  Arginine and proline metabolism
rlt01100  Metabolic pathways
rlt01110  Biosynthesis of secondary metabolites
rlt01130  Biosynthesis of antibiotics
rlt01230  Biosynthesis of amino acids
Module
rlt_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Rleg2_2755
Enzymes [BR:rlt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     Rleg2_2755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NMT1_2
Motif
Other DBs
NCBI-ProteinID: ACI56025
UniProt: B5ZY42
LinkDB All DBs
Position
complement(2799256..2800083)
Genome map
AA seq 275 aa AA seqDB search
MPANAFSSTNPVVLIGAGNMGGAMLSGWLKSGVPGSAVLVIDPGPSPAMLATISEAGATH
VVAAPADLKAGVLFLAVKPQVMETVLPAVRTAVGPETVVVSVAAGKTLGFLEKHLGKAAM
VRAMPNTPAMVGRGVTGAFANSAVSTQQRERVHSLLSVSGPVEWVPAEADIDAVTALSGS
GPAYVFYLVECMAEAGRKLGLQADLAMRLARETVAGAGELLHQSPDDASRLRQNVTSPGG
TTAAALAVLMAENGMQPLFDAALAAARKRAEELAG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgaacgctttctcctcgacaaatcccgtcgtcctgatcggcgccggaaacatg
ggcggggcgatgctctccggctggctgaaaagcggcgtgccgggctctgccgtccttgtc
atcgatcccggcccgtcgccggcgatgctggcgacgatcagcgaggccggcgcgacccat
gttgtcgccgctccagcggatttgaaggcaggcgtgctttttctcgcggtcaagccacag
gtgatggagacggtgctgccggcggtgagaactgccgtcgggccggaaacggtcgtcgtc
tctgtggctgccggcaagacgcttggctttctcgagaaacatctgggcaaagccgccatg
gtgcgggctatgccgaacacgccggccatggtcgggcgcggcgtcaccggcgcctttgcc
aattcagcggtcagcactcagcagcgcgagcgtgtccattctcttctcagtgtctcgggt
cctgtggaatgggtgcctgcagaggccgatatcgatgccgtgacggcgctttcgggcagc
ggtcctgcctatgtgttctatctcgtcgaatgcatggcggaggcaggtcgtaaactcggc
ctgcaggcggacctcgccatgcgtcttgcgcgggaaacagtcgcgggggctggtgaactt
ttgcaccagtcccccgacgacgcttcgcggctgcggcagaatgtgacctctcccggtggc
acgacggcggccgcacttgccgtgctgatggccgaaaacggcatgcagcctctgttcgac
gcagcactcgcagcggcgcgcaagcgggccgaagaactggccggctag

DBGET integrated database retrieval system