KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_2812Help
Entry
Rleg2_2812        CDS       T00779                                 

Definition
(GenBank) anthranilate synthase
  KO
K13503  anthranilate synthase [EC:4.1.3.27]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rlt01100  Metabolic pathways
rlt01110  Biosynthesis of secondary metabolites
rlt01130  Biosynthesis of antibiotics
rlt01230  Biosynthesis of amino acids
Module
rlt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rleg2_2812
Enzymes [BR:rlt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Rleg2_2812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind GATase Peptidase_C26 Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: ACI56082
UniProt: B5ZY99
LinkDB All DBs
Position
complement(2856213..2858402)
Genome map
AA seq 729 aa AA seqDB search
MVTILRDDGAEIYETKGGISVTRQRRAIPYGDAVSSYIDKLDERRGAVFSSNYEYPGRYT
RWDTAVVDPPLGISSFGRNVWIEAYNERGEVLLGFVTERLKTVSDLVLGASSARRLDLSV
KAPDRVFTEEERSKMPTVFTVLRAVTDLFYSQADASLGLYGAFGYDIAFQFDAIDLKLTR
PSDQRDMVLYLPDEILVVDNYAAKAWIDRYDFEKGGVTTEGKAQDIAPEPFKQTDAIPPK
SDHRPGEYADLVVKAKESFRKGDLFEVVPGQKFMERCESKPSDISKRLKAINPSPYSFFI
NLGHQEYLVGASPEMFVRVSGRRIETCPISGTIKRGDDPIADSEQILKLLNSKKDESELT
MCSDVDRNDKSRVCEPGSVKVIGRRQIEMYSRLIHTVDHIEGRLRDDMDAFDGFLSHAWA
VTVTGAPKLWAMRFIESREKSPRAWYGGAIGMVGFNGDMNTGLTLRTVRIKDGIAEVRAG
ATLLNDSIPEEEEAETELKASAMLSAIRDAKTGNSGKTQRDVASVGKGVNILLVDHEDSF
VHTLANYFRQTGASVSTVRTPVPEEIFDRLNPDLVVLSPGPGTPKDFDCKATIKKARARN
LPIFGVCLGLQALAEAYGGELRHLALPMHGKPSRIRVLEPGIVFSGLSKEVTVGRYHSIF
ADPSTLPRDFIITAESEDGTIMGIEHAKEPIAAVQFHPESIMTLGGDAGMRMIENVVAHL
ARKAKTKAA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggtaacgatcctgcgggatgatggtgcggaaatctacgagaccaagggcgggatatcg
gtcacgcggcagcggcgtgcgatcccctacggcgacgcggtctcttcctatatcgacaag
ctcgatgagcgccgcggcgcggtgttttcgtcgaactacgaatatccgggacgttatacg
cgctgggataccgccgtcgtcgatccgccgctcggcatctcctccttcgggcgcaacgtc
tggatcgaagcctataacgaacgcggcgaggtacttctcggcttcgtgaccgagcggctg
aaaacggtgtccgatctcgtgctcggcgcttcctccgcccgccgtctcgacctctcggtc
aaagcgccggatcgggtgttcaccgaggaagagcgctcgaagatgccgacggtctttacc
gtgctgcgtgccgtcaccgacctcttctattcgcaggcggatgcgagccttgggctttac
ggcgccttcggctatgacatcgccttccagttcgatgcaatcgatctgaagctgacccgg
ccctccgaccagcgcgatatggtgctctacctgccggacgaaatcctcgtcgtcgacaac
tatgccgccaaggcctggatcgaccgttacgatttcgaaaagggcggcgtgacgaccgag
ggcaaggcgcaagacatcgcgccggagcctttcaagcaaacggatgccattcccccgaag
agcgatcaccggccgggcgaatatgccgatctcgtcgtcaaggcgaaggaaagtttccgc
aagggcgatctcttcgaagtcgtgcccgggcagaaattcatggagcgctgcgaaagcaag
ccttccgacatttccaagcggctgaaggcgatcaatccgtctccctattccttcttcatc
aatctcggccatcaggaatatctggtcggtgcctcgcccgagatgttcgtgcgcgtgtcc
ggccgccggatcgagacctgcccgatctcgggcacgatcaagcgcggtgacgacccgatc
gccgacagcgagcagatcctgaagctcttgaattccaagaaggacgaatccgagctgacc
atgtgctccgacgtcgaccgcaacgacaagagccgcgtctgcgagcctggctcggtcaag
gtgatcggccgccggcagatcgagatgtattcgcgcctcatccacacggtcgaccatatc
gagggccggctacgcgacgatatggacgccttcgacgggttcttgagccatgcctgggcc
gtgaccgtcaccggcgctccgaagctctgggcgatgcgctttatcgagagccgtgaaaag
agcccgcgcgcatggtatggtggagcgatcggcatggtcggcttcaacggcgacatgaac
accggcctgacgctgcgcacggtgcgcatcaaggacggtatcgccgaggtacgcgccggg
gcgacgctgctcaacgattccattcctgaagaagaagaagccgaaacagaattgaaggcc
tctgccatgctttccgccatccgcgacgccaagaccggcaattccggcaagacccagcgc
gatgtcgcaagcgtcggcaagggcgttaacatcctgctcgtcgaccatgaggacagcttc
gtccacacgcttgccaattatttccgccagacgggggcgagcgtttcgaccgtgcgcacg
ccggtgccggaggaaatcttcgaccggctgaacccggacctcgtcgtgctgtcgcccggg
cctggaacgcccaaggatttcgactgcaaggcgacgattaagaaagcgcgggcgcgcaac
ctgccgatcttcggcgtctgcctcggcctgcaggcgctcgccgaggcctatggcggggaa
ctgcgccatctggcgctgccgatgcacggcaaaccctcgcgcatccgcgtgctggagccg
ggcatcgtcttctccggcctgtcgaaggaggtgacggtcggccgctaccactcgatcttc
gccgatccctcgacgctgccgcgcgacttcatcatcaccgcggaaagcgaagacggcacg
atcatgggcatcgagcacgccaaggagccgatcgccgcggtgcagttccacccggaatcg
atcatgacgctcggcggcgatgctggcatgcggatgatcgaaaatgtcgtggcgcatctg
gcccgcaaggcgaagaccaaggctgcctga

DBGET integrated database retrieval system