KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_2822Help
Entry
Rleg2_2822        CDS       T00779                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00240  Pyrimidine metabolism
rlt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rleg2_2822
Enzymes [BR:rlt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Rleg2_2822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: ACI56092
UniProt: B5ZYA9
LinkDB All DBs
Position
complement(2870811..2871413)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTVQLIAAFDERTGRGVIGSRIGLEASAI
PFEPHEDLFRLIAGLSGEGAPIACVFVDEAHFMTPVHVWQLARVVDRLGIPVMVYGLRTD
FQGKLFPASQELLAIADEMREVRTICHCGRKATMVVRLDAEGKVLHEGAQIDVGGNEKYV
SLCRRHWDEAMNGAWIAEPV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcaactactcgacgatgaacgccggcaaatcgacgatgctgctg
caggcctcctacaattaccaggagcgcggcatgcgcacggtgcaactgatcgccgctttc
gacgagcgtaccggccggggcgtcatcggctcgcggatcgggctggaggcgagcgccatc
cccttcgagccgcatgaagacttgttccggctgatcgcgggcttgagcggcgagggggcg
ccgattgcctgcgtcttcgtcgatgaggcgcatttcatgacgcctgtccatgtctggcag
cttgcccgcgtcgtcgacaggctcggaattcctgtgatggtctatgggctgagaaccgat
ttccagggcaaattgtttccggcctcgcaggaactcttggcgatcgccgacgaaatgcgc
gaggtgcggacgatctgccattgcgggcgcaaggcgacgatggtggtacggctcgacgcg
gaggggaaagtgctgcacgaaggcgcgcagatcgatgtgggcggcaatgagaaatatgtc
tcgctctgccgcaggcattgggacgaagcaatgaacggggcctggatcgccgagccggtc
tga

DBGET integrated database retrieval system