KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_4026Help
Entry
Rleg2_4026        CDS       T00779                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00250  Alanine, aspartate and glutamate metabolism
rlt00410  beta-Alanine metabolism
rlt00640  Propanoate metabolism
rlt00650  Butanoate metabolism
rlt01100  Metabolic pathways
rlt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Rleg2_4026
   00650 Butanoate metabolism
    Rleg2_4026
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rleg2_4026
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rleg2_4026
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rlt01007]
    Rleg2_4026
Enzymes [BR:rlt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Rleg2_4026
Amino acid related enzymes [BR:rlt01007]
 Aminotransferase (transaminase)
  Class III
   Rleg2_4026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ACI57288
UniProt: B5ZVY8
LinkDB All DBs
Position
complement(4199044..4200324)
Genome map
AA seq 426 aa AA seqDB search
MTATSLTDRKNAAISRGVGMTTQIYADRAENAEIWDKEGRRYIDFAAGIAVLNTGHRHPR
VIAAVKDQLDHFTHTCHQVVPYENYVSLAERLNALVPGDFEKKTIFVTTGAEAVENAVKI
ARAATGRSAIIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVFHIPFPVELHGVTAD
QSLAALRKLFAADVDPQRVAAIIIEAVQGEGGFYPAPAAFMKALRELCDQHGILLIADEV
QTGFARTGKMFAMDHHEVAADLTTMAKSLAGGFPLAAVTGRADIMDAPGPGGLGGTYGGN
PIGIAAAHAVLDVIADEDLCNRANLLGGRLKQRLESLRETVPEISDIRGPGFMNAVEFND
RTTGLPSAEFANRVRLTALDKGLILLTCGVHGNVIRFLAPITIQDEVLGEALDILEASML
EVSAAK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgacgagccttacggaccgcaagaacgccgccatttcacggggtgtcggcatg
acgacccagatctatgccgatcgcgccgagaacgcggagatctgggacaaggagggccgc
cgctacatcgatttcgccgccggcatcgccgttctcaacaccggccaccgccatcccagg
gtgattgcggcggtcaaggatcagctcgaccactttacccatacctgccatcaggtggtg
ccctatgagaactatgtcagtctcgccgagcggctgaatgcactggtgccaggtgacttc
gagaagaagacgatcttcgtcaccacgggtgccgaagcggtcgaaaatgccgtcaagatt
gcgcgggcggcaaccggccgctcggctatcatcgcctttggcggcggtttccatggccgt
accttcatgggcatggcgctgaccggcaaggtggtgccctacaaggtcggtttcggcgcg
atgccgggcgatgtcttccatattcccttcccggtcgagctgcacggcgttaccgccgat
cagtcgctggcggcgctgaggaagctctttgccgccgatgtcgatccgcagcgggtcgcc
gccatcattatcgaggccgtgcagggcgaaggcggtttctacccggcgcccgcggccttc
atgaaagcgctgcgcgaactctgcgaccagcacggcatcctgctgatcgccgacgaggtg
cagaccggttttgcccgcaccggcaagatgttcgcgatggatcatcacgaggtggcggcc
gacctgacgacgatggcaaagagccttgccggcggctttccgctcgccgccgtcaccggc
cgcgccgacatcatggacgcgccgggaccgggcgggctcggcggcacttatggcggcaat
ccaatcggaatcgccgcagcgcatgccgtcctcgacgtcatcgccgacgaggatctctgc
aaccgcgccaatctgctcggcgggcggctgaagcagcggctggaatcgctgcgcgagacg
gtgcctgagatctccgatatccgtgggccgggtttcatgaatgccgtcgaattcaacgac
cggacgacgggcttgccgagcgccgaattcgccaatcgagtacggctgacagcgctcgac
aagggcctgatcctgctcacctgcggcgtccacggcaacgtcatccgcttccttgcaccg
atcaccatccaggacgaggtgctcggggaggcgctcgacattctcgaggcctcgatgctg
gaagtgagtgcggccaagtga

DBGET integrated database retrieval system