KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_4830Help
Entry
Rleg2_4830        CDS       T00779                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00473  D-Alanine metabolism
rlt01100  Metabolic pathways
rlt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Rleg2_4830
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Rleg2_4830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rlt01011]
    Rleg2_4830
Enzymes [BR:rlt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Rleg2_4830
Peptidoglycan biosynthesis and degradation proteins [BR:rlt01011]
 Precursor biosynthesis
  Racemase
   Rleg2_4830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACI58069
UniProt: B6A0D5
LinkDB All DBs
Position
pRLG201:473175..474308
Genome map
AA seq 377 aa AA seqDB search
MDSDILVSRTRTNTTAQGATGYLTIDLAALGRNYRKLVSMLAPVRAGAVVKANAYGLGAE
RVATTLYGEGCRHFFVAQFVEAVRLRPTLARDAQIFVLNGLQPGNEIACAERGIVPVLNS
LTQWRQWSATARMLKRCLPAVLQFDTGMSRLGFPEEERSELAAALGDGSNVEILFIMSHL
ASADDMESDQNGEQLAEMARIADEFPGFDISFANSGGVFLGDAYHGVLARPGIALYGGAP
HAGGNNPMEPVVSLDVAVVQTRTVPAGAKVGYGGAHVTQRKMRLATIAAGYADGLPRSLG
DRGAVYYNDIRLPIVGRVSMDSATVDVSALPEGALTLGSLVEVLGSNQTLEHIARDAGTI
SYEILTGLGDRYDKQYR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggatagcgatattttggtttcccgcacacgcaccaacacgaccgcgcagggagccacg
ggctatctgacgatcgatcttgccgcgctcggccgcaactatcgcaagctcgtatcgatg
ttggcgccggtccgcgcgggggcggtcgtcaaggccaacgcctacggccttggcgccgag
cgggtcgcgacaacgctctacggcgaaggctgccggcatttcttcgtcgcccagttcgtc
gaggcggtcaggctgcggccaacccttgctcgcgatgcccagattttcgtactgaacggc
ttgcagccgggcaacgagatcgcctgcgccgagaggggcatcgtcccggttctcaactcg
ctgacccagtggcggcaatggtcggcgacggcgcgcatgctgaagcgctgcctgcctgcc
gtgctgcaattcgacaccggcatgtcgcggctcggctttcccgaggaggaacgctcggaa
ctggcggcagcgcttggcgacggcagcaatgtcgaaatcctgttcatcatgagccatctc
gcttcggccgacgacatggagagcgaccagaacggcgaacagttggccgagatggcccgc
atcgctgacgaatttcccggcttcgacatatccttcgccaattccggcggggtcttcctc
ggcgacgcctatcatggcgtgctcgcccgccccggcatcgcgctttacggcggcgcgccc
cacgcgggcggcaacaacccgatggagccggtcgtcagtctcgacgtcgccgtcgtgcag
acccgcaccgtgccggcaggcgccaaggtcggctatggcggcgcgcatgtcacgcagcgg
aaaatgcgtctcgccaccatcgccgccggttatgccgacggcctgccgaggtcgctcggc
gaccgcggcgccgtctattacaacgacatccgcctgccgattgtcggccgcgtgtctatg
gacagcgcgaccgtcgacgtgtcggcgctgcccgaaggcgccctgacgttgggcagtctg
gtcgaagtgctcggctcgaaccagacgctcgagcacattgcccgcgacgccggcacgata
tcttacgaaatcctaaccggtctgggcgatcgttacgacaagcagtatcgctaa

DBGET integrated database retrieval system