KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5705Help
Entry
Rleg2_5705        CDS       T00779                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Rleg2_5705
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rlt03400]
    Rleg2_5705
Enzymes [BR:rlt01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Rleg2_5705
DNA repair and recombination proteins [BR:rlt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Rleg2_5705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ACI58880
UniProt: B6A397
LinkDB All DBs
Position
pRLG202:103682..106333
Genome map
AA seq 883 aa AA seqDB search
MASDNLSTYRSKRDFKKTAEPSGEKQIARSNRRRFIIQKHDATRLHYDLRLELDGVFKSW
AVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGYWEPEGKKSPE
QALAKGDFKFTLEGERLHGSFVLVRMRNDRDGGKRTNWLLIKHHDAFSVEENGAAVLEEN
DTSVASGRTMDAIATGKGRKPKPFMIKGGDIKADAVWDSNQGLAAEERKEEGRAGRTPKT
AAKVDLPDFIAPQLCQTLERPPAGEGWIHEIKFDGYRIQMRILDGEVTLKTRKGLDWTGK
YPEVAEAASALPDAIIDGEICALDDHGVPDFAALQAALSEGRTGDLVYFAFDLLYEGGED
LRSLPVIERKARLQSLLADAGDDPRLRFVEHFETGGDAVLRSACKLSLEGIVSKQSDAPY
QSGRTDSWAKSKCRAGHEVVIGAYAKTNGKFRSLLVGVYRGDHFVYVGRVGTGYGAKKVE
TLLPKLQALETAKSPFTGIGAPKKEAEVTWVKPKLVAEIEFAGWTADGIVRQAAFKGLRE
DKPAREVKAERPAKPAETDVPEPEPAAEVKARPARRKGAKAEVMGVMISNPDKPLWPDAN
DRKPVTKEELARYYEAVGGWMIAHIEGRPCSIIRAPDGLGGEQFFQRHAMPGTSNLLELV
KVFGDKKPYLQIDRVEGLAAVAQIGAVELHPWNCQPHKPEVPGRLVFDLDPGPDVPFSTV
VSAAREMHDRLDALGLVSFCKTTGGKGLHVVTPLAINKRKPLSWAEAKSFAHDVCQQMAR
DNPDLYLIKMTKSLRNGRIFLDYLRNDRMATAVAPLSPRARPGATVSMPLTWTQVKSDLD
PKRFTIRTVPALLSKSSAWEDYSDGQRPLEQAIKRLSKVSNAA
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgacaacctctcgacataccgatcgaagcgcgactttaaaaaaacggcggag
ccgagcggcgagaagcagatcgcgcgcagcaatcgccgtcgtttcatcatccagaaacat
gacgccacccggctgcattacgacctgcggctcgagctcgacggcgtcttcaaatcctgg
gctgtcaccaaaggcccttcgctcgatccgcacgacaagcggctggccgtcgaggtcgaa
gatcacccgctcgattatggtgattttgaaggcacgatcccgaaagggcaatatggcggc
ggcacggtgatgttgtgggaccgcggctattgggagcctgagggaaagaagagcccggag
caggcgcttgccaagggcgacttcaagttcaccctcgaaggcgaaaggctgcacggcagc
ttcgtcctggtgcgcatgcgcaatgaccgcgacggcggcaagcgaaccaactggctgctg
atcaagcaccacgacgcgttctcggttgaggagaatggcgcagccgtcctggaggagaac
gacacctccgtcgcctccggccggacgatggatgcgatcgccacgggcaagggccgcaag
ccgaagccgttcatgatcaagggcggggatatcaaggcggatgcggtctgggacagcaac
caggggctggccgccgaagagaggaaagaggagggtcgagccggcaggacgccgaaaacg
gcggcaaaggtcgacctcccggatttcatcgcgccacagctttgccagaccctggagcgg
ccgccggccggcgagggctggattcacgagatcaagttcgacggctaccgtatccagatg
cgcatactcgacggcgaggtaacgctgaagacccgcaaagggcttgactggaccggcaaa
tatccagaggtcgccgaggcggcatcggcgctgcccgacgccatcatcgacggcgagatc
tgcgctctcgacgaccatggcgtaccggatttcgcagccctgcaggccgccctttcggaa
ggccggaccggcgatctcgtctatttcgccttcgatcttctttacgagggtggcgaggac
ttgcgatccttgcctgtgatcgagcgcaaggcgcggcttcagagcctgcttgcggatgcc
ggtgacgaccctcggctccgtttcgtcgagcatttcgagaccggcggcgatgcggtcctt
cgctccgcctgcaagctctccctggaaggcatcgtctccaagcagagcgatgcgccctat
caatccggccgcaccgacagctgggccaagtcgaaatgccgcgccggccacgaagtggtg
atcggcgcctatgccaagaccaacggcaaattccgatcgctgctggtcggcgtctaccgc
ggcgaccacttcgtctatgtcggccgcgtcggcacgggatatggcgccaagaaagtggaa
acgttgcttccgaaactgcaagcgctcgagacggcaaaatcgcccttcaccggcatcggt
gcgccgaagaaggaggccgaggtcacttgggtgaagcccaagctcgtggcggaaatcgag
ttcgccggctggaccgccgacggcatcgtccgccaggcggccttcaagggcctgcgggag
gacaagcccgccagggaggtcaaggccgaacggccggccaagccagcggagaccgacgtg
ccggagccggagccggcggcggaggtgaaggcgaggccagcccgccgaaagggcgccaaa
gccgaggtcatgggcgtgatgatctccaatccggacaagccgctttggccggatgccaat
gaccgcaaaccggtgaccaaggaggagctggcccgctattatgaagccgtcggcggctgg
atgatcgcgcatatcgaggggcgcccctgttcgatcatccgtgcgcccgatgggctgggc
ggcgagcagttcttccagcgccatgcaatgcccggcacctcgaaccttctcgaactggtc
aaggtcttcggcgataaaaagccctatctgcagatcgaccgggtcgagggcctagcggct
gtcgcgcagatcggcgccgtcgagttgcacccctggaattgccaaccgcacaagccggag
gtgccgggccggctggtgttcgacctcgaccctggccccgacgtgccgttctcgacagtc
gtttccgccgcccgcgagatgcacgatcggctcgacgcgctcggtctcgtcagtttctgc
aagaccacaggcggcaagggcctgcacgtcgtcacgccgcttgcgatcaataagcgcaag
ccgctttcctgggcagaggcgaagagttttgcgcacgacgtctgccagcagatggcgcgc
gacaatcccgatctctatctgatcaagatgaccaagagcctcaggaacggccgtatcttc
ctcgactatctccgcaacgaccggatggcgacggccgtggcgccattgtcgccccgtgcc
cggccgggcgccaccgtctcgatgccgctgacctggacccaggtcaaatccgatctcgac
ccgaaacgctttaccatccgcaccgtgccggcactgctgtcgaaatcgtcggcctgggaa
gattatagcgatggccagcgcccgctggagcaggcgatcaaacggctgagcaaagtctcg
aacgcggcgtga

DBGET integrated database retrieval system