KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5833Help
Entry
Rleg2_5833        CDS       T00779                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00040  Pentose and glucuronate interconversions
rlt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rleg2_5833
Enzymes [BR:rlt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     Rleg2_5833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ACI59006
UniProt: B6A3M3
LinkDB All DBs
Position
pRLG202:complement(242946..243989)
Genome map
AA seq 347 aa AA seqDB search
MTKVRALVLERQHELALRDIDLPLETGPGQVKIKIHTVGVCGSDVHYYTHGKIGPFIVNA
PLVLGHEAAGTVVEVGAGVTHLKVGDRVCMEPGIPDPNSKASRLGMYNIDPAVTFWATPP
IHGVLTPEVVHPANYTFKLPDNVSFAEGAMVEPFAVGMQAASKAKITPGDTAVVLGAGPI
GTMVAIAALAGGCARAIVADLAQPKLDISAQYQGVIPVNIREKSLSEEVVRLTDGWGADV
VFECSGSPKAWETIMALPRPGGVIVAVGLPVNPIGFDVSTASTKEIRIETVFRYAHQYER
SIALLASGRVDLKPLISETFTFEESIKAFDRAVEARPSDVKLQIVME
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtccgtgcgctggtactggagcgccagcatgagcttgcgcttcgcgatatc
gatctgccgctcgaaacaggaccggggcaggtcaagatcaagattcataccgtcggcgtc
tgcggttcggacgtccactattatacccatggaaagatcggccccttcatcgtcaatgcg
ccgctggtgctcggtcatgaggcggcaggcacggtggtcgaagtcggggctggtgtgacg
catctgaaggttggcgaccgggtctgcatggagcccggcattcccgacccgaattccaag
gctagccggctcggcatgtacaatatagacccggccgtgaccttctgggcgacgccgccg
atccatggcgtgctgacgccggaggtcgtgcatccggccaattataccttcaaactgcct
gataatgtcagcttcgccgagggcgccatggtcgagccctttgccgtcggcatgcaggcg
gccagcaaagccaagattacacccggcgataccgccgtcgtcctcggcgccgggccgatc
ggcacgatggtggcgattgccgctcttgccggcggctgcgcccgggcgatcgtcgccgat
ctcgcccagccgaagctcgatatatcagcgcaatatcagggcgtcatcccggtcaacatc
cgcgaaaagagcctgagcgaagaggtcgtccggctgaccgacggttggggtgccgacgtc
gtcttcgaatgctccggctcgccgaaggcctgggagacgatcatggcgctgccgcgcccg
ggcggcgtcatcgtcgccgtcggcctgccggtcaacccgatcggtttcgatgtctcgacg
gcatcgaccaaggagatccgtatcgagacggtgttccgctacgcgcaccaatacgagcgc
tcgatcgcgctcctggcatccggccgcgtcgatctgaagccgctgatatccgagaccttc
acattcgaggagtcgatcaaggccttcgatcgcgccgtcgaggcgcggccgagcgacgtc
aagctgcagatcgtcatggagtag

DBGET integrated database retrieval system