KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_6470Help
Entry
Rleg2_6470        CDS       T00779                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00564  Glycerophospholipid metabolism
rlt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rleg2_6470
Enzymes [BR:rlt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Rleg2_6470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 Pyr_redox_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ACI59352
UniProt: B6A4W9
LinkDB All DBs
Position
pRLG204:complement(135490..137004)
Genome map
AA seq 504 aa AA seqDB search
MGREIYDIFVIGGGINGCGIARDAVGRGYSVALAEMNDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREILWAMAPHIIWPLRFVLPYHKGGIRPAWLIRLGLFLYDHLGGRKLL
PATAVLDMRRDPAGKPLKALFTKAFEYSDGWVDDARMVVLNARDAADKGATIMSRTKVVS
ARRENGLWLIETTDTVTGRNDSHQARMLVNAAGPWVDHVIRSAFGQNEAHHVRLVQGSHI
VVKKKFDDARAYFFQNPDNRIIFAIPYEGDFTLIGTTDRDYTADPRDVRISEEETVYLCN
AASEYFKEPVRPEDIVWTYSAVRPLYDDGASKAQEATRDYVLKLEGEGNAAPLLNVFGGK
LTTYRRLSEHALEKIGAAIGVKGAPWTAKSHLPGGDFPVRGYDAEVADLKRRYPFLADRH
ARRLVRRYGTRTKTLLGEARGLDDLGRLFGGDLYEAEVTYLVEHEWARHAEDVLWRRTKD
GLRLSKEQAQSLEEYMAAIPAMVG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttgggccgggagatctacgacatattcgtcattggtggcggcatcaacggctgcggcatt
gcgcgcgatgccgtcgggcgcggttattccgtggcgctggccgagatgaacgatttcgcc
tccggcacctcatccggcgctaccaagctgatccatggcgggttgcggtatctcgagcat
tacgagttccgcctggtgcgcgaatcgctgatggagcgcgagatcctctgggcgatggcg
ccgcatatcatctggccgctgcgcttcgtgctgccttaccacaagggcggcatccggccg
gcctggctgatccggcttggcctcttcctttacgaccatctcggcggccgcaagctgctg
ccggcgaccgcggtgctcgacatgcgccgcgacccggccggcaaaccgctgaaggcgctg
tttaccaaggccttcgaatattccgacggctgggtcgatgacgcccgcatggtggtgctg
aacgcccgcgatgccgccgacaagggagcgaccatcatgtcgcgcaccaaggtggtgtcg
gcaaggcgcgagaacggcctctggctcatcgagaccaccgataccgtcaccggccgcaat
gacagccaccaggcccgcatgctggtcaacgccgccggtccctgggtcgaccatgtcatc
cgctccgcctttggccagaacgaggctcaccacgtccgtctcgtccagggcagccatatc
gtggtgaagaagaagttcgacgacgctcgcgcctatttctttcaaaatcccgacaatcgc
atcatcttcgccattccctatgagggcgactttaccctgatcggcaccaccgatcgcgat
tacaccgctgatcccagggatgtccggatctccgaggaggagaccgtctatctctgcaac
gccgcctcggaatatttcaaggagccggtcagaccggaggatatcgtctggacctattcg
gcggtccggccgctttatgacgacggcgcctcgaaggcgcaggaggcgacgcgcgactac
gtgctgaagctggagggcgaaggaaatgccgcgccgctgctcaacgtcttcggcggcaag
ctcaccacctatcgccggctttccgaacatgcgctggagaagatcggtgctgcgatcggc
gtcaagggcgccccgtggacggccaaaagccatctgcccggcggcgacttcccggtccgg
ggatacgatgccgaggtcgccgatctgaagcggcgttatccgttcctcgccgatcggcat
gcccgccggctggtgcggcgctacggcacaaggacaaagacgctgctcggtgaagcccgc
ggcctcgacgatctcggacggctgttcggcggtgatctctacgaggccgaggtcacctat
ctcgttgaacatgaatgggcccggcacgccgaagacgtgctgtggagaaggacaaaggat
ggtctgcgcctttccaaggagcaggctcagtcactggaggagtacatggctgccataccg
gcgatggtcggatag

DBGET integrated database retrieval system