KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_08605Help
Entry
RLEG12_08605      CDS       T03015                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
rlu00250  Alanine, aspartate and glutamate metabolism
rlu00280  Valine, leucine and isoleucine degradation
rlu00410  beta-Alanine metabolism
rlu00640  Propanoate metabolism
rlu00650  Butanoate metabolism
rlu01100  Metabolic pathways
rlu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rlu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RLEG12_08605
   00650 Butanoate metabolism
    RLEG12_08605
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RLEG12_08605
   00280 Valine, leucine and isoleucine degradation
    RLEG12_08605
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RLEG12_08605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rlu01007]
    RLEG12_08605
Enzymes [BR:rlu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RLEG12_08605
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     RLEG12_08605
Amino acid related enzymes [BR:rlu01007]
 Aminotransferase (transaminase)
  Class III
   RLEG12_08605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AHG48990
LinkDB All DBs
Position
unnamed:complement(1008810..1010090)
Genome map
AA seq 426 aa AA seqDB search
MAETELKTASFLSRRKESIPRGIVTAHPVVAARAKGSELWDVDGRRYLDFVGGIGVLNIG
HNHPRVVDAVKAQLDKVTHACFQVVGYEPYIALSEKLNGLVGEGYKSVFFTTGAEAVENA
VKIARGYTNRAAVIAFRGGFHGRTLLGITLTGMSQPYKQNFGPFAPEVYHIPYPNAYQGV
TTEDALGALEEIFATAAMPDRVAAIIIEPVQGDGGFLAAPVEFIQSLREVTRKHGIVLIA
DEIQTGFGRTGKMFGFQHSGIEPDLVTVAKSLAAGFPLSGVIGKSEIIDAPLPGGLGGTY
GGNAISCAAALAVLEAFEEENLLENGRQRAAELKAGLESLQQKFDFVGEVRGLGFMLAME
IVKDRKSKAPDADHTQRILDEACKAGLLVIKCGVHRNVVRFLAPLVTTSVQIQEALAIVD
KALAAA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaccgaattgaaaactgcctccttcctctcacgccggaaggaaagcatcccg
cgcggcatcgtcaccgctcatccggtggtcgctgcgagggccaaaggaagcgaactctgg
gacgtcgatggccgccgttatcttgactttgttggcggcataggtgtgctgaacatcggc
cacaaccatccgcgcgttgtcgatgcagtcaaggcgcaactcgacaaggttacacatgcc
tgcttccaggtggtgggctacgagccatatatcgccctgtcggaaaaactgaacggcctc
gttggtgaagggtacaagagcgtgttcttcacgactggtgccgaagccgtagaaaatgcg
gtgaagattgcccgtgggtacaccaaccgagcagcggtcattgcgtttcgcggtggcttc
catggccgcacgctgctgggaattaccctgaccggcatgagccagccctacaagcagaat
tttggccccttcgcgcccgaagtctaccatatcccgtatccaaacgcctatcagggagtt
acgaccgaggatgcacttggcgcgctcgaggagatttttgccacagcggcaatgccagat
cgtgtcgccgctatcatcatcgaaccggtccagggggatggaggtttcctggccgccccg
gttgaatttattcagtcgctacgcgaggtcacccggaaacacggcattgtactgatcgcc
gacgaaatccagaccgggttcggtcgcacgggcaaaatgttcggctttcagcattccggt
atcgaacccgacctggtcacagtcgccaaaagcctggcagccggtttcccattgtcgggc
gtcatcggcaagtcagagatcatcgacgcgccgcttccgggcgggctcggcggcacctat
ggcggcaatgcgatctcgtgcgctgcggcactagcggtgcttgaggcatttgaggaggag
aacttgctggaaaacggtcggcagcgcgcggcagagctcaaggcgggcctcgaatccctg
cagcaaaaattcgactttgtcggcgaagtgcgcgggctcggcttcatgctggcgatggaa
atcgtcaaggaccgcaagagcaaggcgccggatgcggaccatacccagcgcattctcgac
gaagcttgcaaagcggggctcctggtcatcaaatgcggcgtacatcgcaacgttgtgcgt
ttccttgcaccgctggtgaccacaagcgtgcagattcaggaagctttggcgatcgtcgac
aaggcacttgcagcagcctga

DBGET integrated database retrieval system