KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_10460Help
Entry
RLEG12_10460      CDS       T03015                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
rlu00500  Starch and sucrose metabolism
rlu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RLEG12_10460
Enzymes [BR:rlu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     RLEG12_10460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AHG49359
LinkDB All DBs
Position
unnamed:complement(1388061..1389467)
Genome map
AA seq 468 aa AA seqDB search
MSGANPAHIGANAPTVKPRPAFAQTDLVALSRYFSLLMMRNITSDGYVIEDPASPGVFSA
PGCVIAAPSYPANTPGVDQDYVFNWVRDGAITAIEIALAGLLPVPGGVLPSLVDYVNFAA
LCQANAKNSATVTLGHACFTITGEVRPWSEQNDGPAIQSIAIMTLFDQLDGATQTIAKQL
VETNLSYLLEVYQNKTTNLWEEYEGYSFFARAVQLRFFREISTNTIGIAVPAGVADAISW
LESQLATHWNGQLYVSILDAAAEQAGYDANIDIVSSVCYGGIEAADTKLLATAAILRRQW
ADPSSSNYFPVNGADAAKGLGPLFGRYPGDHYDGDVAAPVVGGHPWALCTANFAEFQYRL
ANAIDASGAIPLDQFSEPFFAELGLGASNSTAEASAALRASSDVMLRAIVYHSDHYELSE
QFDGTVGYEKSVRNLTWSYAAFLSAVRARSPAAPAAKSKPRNSRGPRS
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtgcgaacccggcccatatcggcgccaatgcgccgacagtcaaaccgcggcct
gccttcgcgcagaccgatctggtcgcattgtcgcgctatttttctcttctgatgatgcgc
aacatcaccagcgatggctatgtcatcgaggatccggcatcgcccggcgtattctccgcc
cccggctgcgtcatcgccgccccctcctatccagcgaacacgccgggtgtcgaccaggac
tatgttttcaactgggtccgcgacggggcgattacggccatcgagatcgcgcttgccggc
ttgctgcccgttccgggcggggttttgccgagcctggtcgactatgtgaacttcgccgcg
ctctgccaggcgaatgcgaagaattccgcgaccgtcacacttggccacgcctgcttcacc
atcaccggcgaggttcgtccgtggtcggagcagaatgacgggccggccattcagtcgatt
gcgatcatgaccttgttcgatcagttggatggcgccacgcagacgatcgcaaaacaattg
gtcgagaccaacctctcttaccttctcgaagtttaccagaacaagaccacaaatctctgg
gaggaatatgaaggctattcgttttttgcaagagccgtacagctgcgctttttccgggaa
atttccacgaacacgatcggtattgcggtgcctgccggggtggccgatgccatatcctgg
ctggaaagccaactggccacccactggaacgggcagctctatgttagcattctggatgcc
gccgcggagcaagccggttatgacgcgaacatcgatatcgtctcctcggtctgctatggc
gggatcgaagcggccgataccaagcttctggcaacggcggccatcctgcggcgccagtgg
gccgatccttcgtcttcgaactatttcccggtcaatggcgccgacgcggccaaggggctc
ggaccgctcttcgggcgctatccaggcgatcactacgatggcgatgtggcggctccggtg
gtcggcgggcatccctgggctctgtgcaccgccaacttcgccgagtttcaatatcggctt
gccaatgccatcgatgccagcggcgccatccccctcgatcagttctccgaacccttcttc
gcggaactgggacttggcgcatccaacagcaccgccgaagcgtcggctgccctgcgggct
tcatctgacgtcatgctgcgcgccatcgtctatcacagcgatcactacgagctgagcgaa
cagttcgatggtaccgtcggctacgagaaaagcgtccggaatctgacctggagctatgcc
gcctttctctccgcggtcagagcccgctctcccgccgccccggccgccaaatccaaaccc
cgaaactcccgcggcccgagatcatga

DBGET integrated database retrieval system