KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_12700Help
Entry
RLEG12_12700      CDS       T03015                                 

Definition
(GenBank) iditol 2-dehydrogenase
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AHG44030
LinkDB All DBs
Position
266049..267059
Genome map
AA seq 336 aa AA seqDB search
MRAVRLESIGSLTMRSVEKPVAGPGELLVRVVAAGICGSDRHMFKGEYPTSIPVTLGHEF
SGIVEAIGDGVSRFAGGELVTVDPNIACGTCPACTRGRPNLCESLTAIGVTRDGGFAEYV
AVPHAQAFMLPADLDPVHGAFSEPLACCIHAIDKAGIRPGDGVAILGGGVIGLLMVQLAR
LAGAAKIILVTRQQSRRQTALHLGATNAFDPVSSDTIASVREVTKGGADVVIECAGVSDT
LQSGLKMARRGGTFVLFGVTPAGVEVPVLPFDLLINEVDIRPAYLNPFTHSRAAAMVASG
ALELDALVTRTIGLEEVAEVVGNAPLPGEIKVIVRP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagagctgtacgcttggagtcgatcgggtctttgaccatgcgcagcgtcgagaagccg
gttgccgggccgggcgagttgcttgtccgggtcgtggcggcaggcatctgcggttccgat
cgccacatgttcaagggcgaatatccgacctccatccccgtcaccctgggccacgaattt
tcaggcatcgtggaagcgattggcgatggtgtctcccgctttgccggcggtgagctggtg
acggtggatccgaatattgcctgcggcacctgtccggcttgcacgcgagggcggccgaac
ttgtgcgagagcctcaccgccatcggcgtaacgcgggatggcggctttgccgaatatgtc
gcggtgccgcatgcgcaagcattcatgctgccggccgacctcgatcccgttcacggcgcc
ttcagcgaaccactggcctgctgtatccacgccatcgataaggcagggatccgtccgggc
gatggcgtggcgatcctcggcggcggcgtgatcggcctgctgatggtgcaactggcccgc
ctggccggggcggccaagattattttagtgacgcgtcagcaatcgagacgccaaaccgct
ctgcacctgggcgcgacgaacgccttcgacccggtctcgtcggatacgattgcttcggtc
cgggaggtgacgaaaggcggcgcagatgtggtgatcgaatgcgccggcgtcagcgacacg
cttcaaagcggtctgaagatggcgcggcgcggcggcaccttcgtgcttttcggggtcacg
ccggcgggtgtcgaggtgccggttctgccattcgatctgctgatcaacgaagtcgatatc
aggcccgcctacctcaaccccttcacccattcgcgcgctgcggcaatggtcgcaagcggg
gcattggaactggacgcattggtcaccagaaccatcggtctcgaggaggtcgccgaggtg
gtgggcaacgcgcccttgccgggcgagatcaaggtcatcgtccggccctag

DBGET integrated database retrieval system