KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_13675Help
Entry
RLEG12_13675      CDS       T03015                                 

Definition
(GenBank) 3-methyladenine DNA glycosylase
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
rlu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:rlu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    RLEG12_13675
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rlu03400]
    RLEG12_13675
Enzymes [BR:rlu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     RLEG12_13675
DNA repair and recombination proteins [BR:rlu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     RLEG12_13675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenine_glyco DUF4597
Motif
Other DBs
NCBI-ProteinID: AHG44211
LinkDB All DBs
Position
469025..469654
Genome map
AA seq 209 aa AA seqDB search
MSETGIIIGEDGRSRCHWHANLPDYLRYHDEEWGRPVTNDIRLFEKICLEGFQSGLSWLT
ILRKRENFRSAFAGFDFEKVALFGDEDVTRCLGDAGIIRHRGKIVSTVNNAKRAIALRDE
FGSLAHYFWRYEPGHNERPVVVDRQHIAANPTTPTSVIISKDLKKRGWTFVGPTTVYAFM
QAMGLVNDHLEGCFCRPEVEAMRAVLVRP
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagacaggcatcatcatcggcgaggacggcaggagccgctgccactggcacgcc
aatctgccggattatctccgctatcatgacgaggaatggggccgcccggtcaccaacgac
attcgcctcttcgagaagatctgcctcgaaggtttccagtccggtctttcctggctgacc
atcctgcgcaagcgcgagaacttccgctcagcctttgccggcttcgatttcgaaaaggtc
gcccttttcggcgatgaggatgtcactcgttgccttggcgatgccggcatcatccgccac
cgcggcaagatcgtctcgacggtcaacaatgccaagcgcgccattgcgctgagggacgaa
ttcggctcgctcgcccattatttctggcgctatgagccgggccataacgagcggcctgtt
gtggtcgaccgtcagcatatcgccgccaatccgacgacgccgacctcggtcatcatttcc
aaggatctgaagaaacgcggctggacctttgtcggcccgaccacagtttatgctttcatg
caggcgatgggtctcgtcaacgatcatctggagggctgtttctgccggcctgaggtcgag
gcgatgcgcgccgttttggtccgaccatga

DBGET integrated database retrieval system