KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_21200Help
Entry
RLEG12_21200      CDS       T03015                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
rlu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rlu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RLEG12_21200
Enzymes [BR:rlu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RLEG12_21200
Transporters [BR:rlu02000]
 Other Transporters
  Pores ion channels [TC:1]
   RLEG12_21200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: AHG45596
LinkDB All DBs
Position
1926286..1926912
Genome map
AA seq 208 aa AA seqDB search
MTEELVFYTNPMSRGRIARWMLEEIGHAYRTELLTFGEGMKAPEYLRVNPMGKVPAIRHG
DTIVTECAAICAYLAETFPEKGLAPKPEERAAYYRWMFFAAGPLESAVTMRSLGFEIPTE
RLRMAGCGGFGDVMNTLEMAVSGSTYVAGERFTAADVYVGSHVGWGLGFGSIEKRQAFVD
YFGRISEREAYKRANALDDEAGKTMQAA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagaactggtattctacaccaaccccatgtcgcgcggccgcatcgcgcgctgg
atgctggaggagatcggccatgcctatcgcaccgaacttctgactttcggtgaaggtatg
aaggcgccggaatatctacgggtcaatccgatgggcaaggtgccggcaatccgccacggc
gataccatcgtcaccgaatgcgcggcgatctgcgcctatctcgccgagaccttcccggaa
aaggggctggcccccaaaccggaagagcgcgccgcctattaccgctggatgttcttcgcc
gccggtccgctggaatcggcagtgacgatgaggtcgctcggcttcgaaattccgacggag
cgcctgcgcatggccggttgcggcggtttcggcgacgtcatgaacacactcgaaatggcc
gtctccggctcgacctatgtcgccggcgaacgcttcaccgccgccgacgtctatgtcggc
tcgcatgtcggctggggtcttggcttcggcagcatcgaaaaacgccaggccttcgtcgat
tatttcggccgcatcagcgaacgtgaggcctacaagcgcgccaatgcactggacgacgag
gccggcaagacgatgcaggccgcttga

DBGET integrated database retrieval system