KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_21735Help
Entry
RLEG12_21735      CDS       T03015                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K02483  two-component system, OmpR family, response regulator
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Brite
KEGG Orthology (KO) [BR:rlu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rlu02022]
    RLEG12_21735
Two-component system [BR:rlu02022]
 OmpR family
  Unclassified
   RLEG12_21735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AHG45697
LinkDB All DBs
Position
complement(2044369..2045109)
Genome map
AA seq 246 aa AA seqDB search
MDHVDHILVVDDDREIRELVSGYLQKNGLRTSVAADGRQMRSFLDANAVDLIVLDVMMPG
DDGLVLCRELRSGRHKAIPILMLTARTDEMDRILGLEMGADDYLAKPFAARELLARIKAV
LRRTRMLPPNLQISEAGQLLSFGDWRLDTVARHLLDKEGTAIALSGAEYRLLRVFIDHPQ
RVLNRDQLLSLTQGRDADLFDRSIDLLVSRLRQRLGDDAREPTYIKTVRSEGYVFSVPVE
ITELRQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggatcatgtcgatcacatcctggtcgtcgatgacgatcgcgaaatccgcgaacttgtt
tcgggctatctgcagaagaatggcctgaggaccagcgttgccgcggacgggcgccagatg
cgcagctttctcgacgccaatgccgtcgacctgatcgtgctcgacgtgatgatgcccggc
gacgacgggctggtgttgtgccgcgagctgcgctccggccggcataaggcgatcccgatc
ctcatgctgacagcccgcaccgacgagatggaccggatactcggattggagatgggcgcc
gacgactatctcgccaagccctttgccgcgcgcgagctgctcgcccgcatcaaggcggtg
ctgcgtcgcacgcgcatgctgccgcccaacctgcagatcagcgaggcggggcaactgctg
agcttcggcgattggcggctcgatacggtcgcccggcatcttctcgacaaggaggggacc
gcgattgcgcttagcggcgccgaataccgcctgcttcgggtcttcatcgatcacccgcag
cgggtgctcaatcgcgatcagctgctgagcctgacgcagggccgcgacgccgatctgttc
gatcgttcgatcgatctcctggtcagccgcttgcgccagcgactgggggacgacgcacgc
gaaccgacctacatcaagaccgtgcgcagcgaaggctatgtcttttccgttccggtcgaa
atcacggagctgcgtcaatga

DBGET integrated database retrieval system