KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_22005Help
Entry
RLEG12_22005      CDS       T03015                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
rlu00473  D-Alanine metabolism
rlu00550  Peptidoglycan biosynthesis
rlu01100  Metabolic pathways
rlu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rlu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    RLEG12_22005
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RLEG12_22005
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    RLEG12_22005
Enzymes [BR:rlu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RLEG12_22005
Peptidoglycan biosynthesis and degradation proteins [BR:rlu01011]
 Precursor biosynthesis
  Amino acid ligase
   RLEG12_22005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 RimK
Motif
Other DBs
NCBI-ProteinID: AHG45749
LinkDB All DBs
Position
2096972..2098048
Genome map
AA seq 358 aa AA seqDB search
MTPSPNRLRIAVLFGGRSAEHEVSILSATNVMAALEPEKYDAVPIFVTREGQWLLSGFGD
GRLATPSSGTEICLVPGGRGRMLAMPAHGAPHELPRIDILFPVLHGPHGEDGSVQGAVEV
ARVPLAGCGILGSAAALDKDIAKRLLQAAGLPVARAVTIHEGAAPSLAALEDELGLPLFV
KPARQGSSVGVAKVHASQEFAAALAGGFRHDRTLLAEEFIAGREIEFSVLEDVDGELFVS
RPGEIVPAESHGFYNYDAKYVDENGAALKVPAELPLEVETAMRDMAAQAFRAVGCDGMAR
IDFFLTSDMHFVINELNTIPGFTDISMYSKALAASGVSYAEIIDRLVEHGMARFRRTG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaccccttcccccaacaggctgcgcatcgccgtgcttttcggtggccgttcggccgag
cacgaggtttccatcctctcggcgaccaacgtcatggctgcgctggagcccgagaaatat
gacgccgttcccatcttcgtcacccgtgagggacaatggctgctgagcggcttcggggac
ggccggctggcgacaccctcgtcagggacggaaatctgcctcgtgccgggcggccgcggg
cgcatgctggccatgccggcccatggcgcgccgcatgaattgccaaggatcgacatcctg
tttcccgtgctgcacggcccgcatggcgaggacggatcggtgcagggcgcagttgaagtg
gcacgcgtgccgctcgccggctgcggcatcctcggctcggccgcggcactggacaaggat
atcgccaagcgtctgctgcaggcggcgggcctgccggtggcgcgcgccgtgacgatccat
gagggtgcggctccttcgcttgccgcgctcgaagacgagctcggcctgccgctctttgtc
aagccggcgcggcagggatcctccgtcggcgtcgccaaggtccatgccagccaggaattt
gcagcagcccttgccggaggcttccgccacgaccggacgctgctcgccgaggaattcatc
gccggccgcgagatcgaattcagtgtgctggaggatgtggacggagagctttttgtctcc
cggccgggtgagatcgtgccggcggaaagccacggcttctacaattacgacgccaaatat
gtcgatgaaaacggcgcggcgctgaaagtcccggccgagttgccgctggaggtcgagacc
gccatgcgcgatatggccgcccaagctttccgggctgtcggttgcgatggcatggcgcgc
atcgactttttcctgacatcggacatgcacttcgtcatcaacgaactcaacaccattccc
ggcttcaccgatatcagcatgtattccaaggcgttggcagcaagcggcgtcagctatgcc
gaaatcatcgaccggctggtggagcacggcatggcgcgcttccgccggacaggctag

DBGET integrated database retrieval system