KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_25350Help
Entry
RLEG12_25350      CDS       T03015                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
rlu00240  Pyrimidine metabolism
rlu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RLEG12_25350
Enzymes [BR:rlu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RLEG12_25350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AHG46361
LinkDB All DBs
Position
complement(2746312..2746914)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTVQLIAAFDERTGRGIIGSRIGLEASAI
PFEPHEDLFRLISTLSGEGAPIACVFVDEAHFMTPVHVWQLARVVDRLGIPVMVYGLRTD
FQGKLFPASQELLAIADEMREVRTICHCGRKATMVVRLDAEGKVLHEGAQIEVGGNEKYV
SLCRRHWDEAMNGAWIAEPV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcaactactcgacgatgaacgccggcaagtcgacgatgctgctg
caggcctcctacaattaccaggagcgcggcatgcgcacggtgcaattgatcgccgctttc
gacgagcgcaccggccgcggcatcatcggctcgcggatcgggctggaggcgagcgccatt
cccttcgagccacatgaggacctgttccggctgatttcgacgctgagcggggaaggggcg
ccgattgcctgtgtcttcgtcgacgaggcgcatttcatgacgcctgtccatgtctggcag
cttgcccgcgtcgtcgacaggctcggcattcccgtgatggtctatgggctgagaaccgat
ttccagggcaaattatttccggcttcgcaggaactgttggcgatcgccgacgaaatgcgc
gaggtgcgcacgatctgccattgcgggcgcaaagcgaccatggtggtgcgactcgacgcg
gaagggaaagtgctgcacgaaggcgcgcagatcgaggttggcggcaatgagaaatatgtc
tcgctctgccgcaggcattgggacgaagcgatgaacggagcctggatcgccgagccggtc
tga

DBGET integrated database retrieval system