KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_28725Help
Entry
RLEG12_28725      CDS       T03015                                 

Definition
(GenBank) adenylate cyclase
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
rlu00230  Purine metabolism
rlu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RLEG12_28725
Enzymes [BR:rlu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     RLEG12_28725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc
Motif
Other DBs
NCBI-ProteinID: AHG46992
LinkDB All DBs
Position
complement(3455072..3456289)
Genome map
AA seq 405 aa AA seqDB search
MDYSDVSTIAAWITEQGLKGASESELMTGFCAACRNAGLPLDRGMALMDTLHPVHEGRAF
RWDSVEEIETEFEYGPSGVGEAAASWQRSSFYYLWSGNEREVRRRIGFGDPIDFSMLDTI
AAAGHTDYIAMMHRFAEAGTIGEMDCFFSNFSTKHPEGFSDHDLAILRKLVPVLGLAIKC
IALGRIARTIAEVYLGEDAARQVMEGKISRGKSERISAALWFSDLLNYTKISDRVPPEEI
IPLLNDYSEVVISAIHEAGGNVLKLIGDGVLAIFKGEVPAETCRAALQAQSLLREKLAKL
NAEREADNRPTTDVYIGLHIGDVFYGNIGSQDRLDFTVIGPAVNEVSRIASMCRSVDLNL
LISSDFAAAIPEAQRAAIACVGRYALRGVQRAQELYTLDGARLNA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggattacagcgacgtcagcacgattgcggcctggatcaccgagcagggactgaagggc
gcttcggaatccgaactcatgaccggtttctgcgcagcctgccggaacgccggcctgccg
ctcgaccgcggtatggcgctgatggatactctgcacccagtgcatgagggccgtgccttc
cgctgggatagcgtggaggagatcgagaccgaattcgaatatggcccgtcgggtgtgggc
gaggcggctgcgagttggcagcgttcgtccttctattatctctggtccggcaacgaacgg
gaggtgcgccgccgcatcggcttcggcgatccgatcgatttcagcatgctcgacacgatc
gctgcggccggccataccgattacatcgcgatgatgcatcgttttgccgaggccggcacg
atcggcgagatggattgcttcttctcgaatttctcgacgaagcaccccgaaggcttttcc
gatcacgacctcgccatcctgcgcaagctggtgccggtcctcggattggcgatcaagtgt
atcgcgctcgggcgcatcgcccgcaccattgcggaagtctatctcggcgaggatgcggcg
cgccaggtgatggaaggcaagatcagccgcggcaaatcggagcggatttcggccgcactc
tggttttccgatctgctgaattacaccaagatttccgatcgggtgccgccggaggaaatc
atcccgctgctcaacgattatagcgaggtggtgatttcggcgatccatgaggccggcggc
aatgtgctgaagctgatcggcgacggcgtgctcgccatcttcaagggcgaggtgccggcg
gagacctgccgtgcggcgctccaagctcaatcgcttctgcgcgaaaagcttgccaagctc
aacgccgaacgcgaggccgataacaggccaacgacggatgtctatatcggcctgcatatc
ggcgatgtcttctacggcaatatcggtagccaggaccggctggatttcactgtcatcggc
cctgcagtcaatgaggtcagtcgcatcgcttcgatgtgccgttcggtcgatctcaacctg
ctgatctcctccgatttcgccgcggcgatcccggaagcacagcgcgcggcaatcgcctgc
gtcgggcgttatgcattgcgcggcgtgcagcgcgcgcaggagctctatacgctcgacggc
gcccggctgaacgcctga

DBGET integrated database retrieval system