KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_28850Help
Entry
RLEG12_28850      CDS       T03015                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
rlu00010  Glycolysis / Gluconeogenesis
rlu00620  Pyruvate metabolism
rlu01100  Metabolic pathways
rlu01110  Biosynthesis of secondary metabolites
rlu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rlu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RLEG12_28850
   00620 Pyruvate metabolism
    RLEG12_28850
Enzymes [BR:rlu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     RLEG12_28850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AHG47017
LinkDB All DBs
Position
3485336..3486844
Genome map
AA seq 502 aa AA seqDB search
MLHQKIVESPFKLKYGNYIGGEWREPVEGKYFENLTPVTGGKLCDIPRSNEKDINLALDA
AHAAKEKWGRTSAAERSNILMKIAQRMEDKLELLAQAETWDNGKPIRETMAADIPLAIDH
FRYFASCIRAQEGSIGEIDHDTVAYHFHEPLGVVGQIIPWNFPILMATWKLAPALAAGNC
VVLKPAEQTPASILLWAELVGDLLPPGVLNIVNGFGLEAGKPLATSPRVAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKALEGFAMFALNQGEVCTCP
SRALVQESIYDRFMEKAVKRVEAIKQGNPLDSATMIGAQASTEQLEKILAYLDIGKQEGA
EVLTGGTRNDLGGDLANGYYVKPTIFKGHNKMRVFQEEIFGPVVSVTTFKNEKEALEIAN
DTLYGLGAGVWSRDANRCYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LEHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcttcatcagaaaatcgtcgagtcgccgttcaagctgaaatacggcaattatatcggc
ggcgaatggcgcgagccggtcgaaggcaaatatttcgaaaacctgacgcccgtcaccggc
ggcaagctctgcgacattccccgttccaatgaaaaggacatcaatctggcgctcgacgcc
gcccatgcggccaaggaaaaatggggccgcacctcggctgccgaacgctccaatatcctg
atgaagatcgcccagcgcatggaagacaagctggaattgctcgcccaggccgaaacctgg
gacaacggcaagccgatccgcgagaccatggcggcagacattccgctggcgatcgaccac
ttccgctacttcgcttcctgcatccgcgcccaggaaggttcgatcggcgaaatcgaccac
gacaccgtcgcctatcacttccacgagccgctcggcgtcgtcggccagatcattccgtgg
aacttcccgatcctaatggcgacctggaagctggcgccggcacttgccgccggcaactgt
gtcgtcctcaagcctgccgagcagaccccggcttcgatcctgctctgggccgaattggtc
ggcgatctcctgccgcccggcgtgctcaacatcgtcaacggtttcggcctcgaggccggc
aagccgctggcgaccagcccccgcgttgccaagatcgccttcaccggcgagacgacgacc
ggccggctgatcatgcaatatgccagccagaacctcattccggtgacgctggaactcggc
ggcaaatcgccgaacatcttcttcgccgatgtgatggccgaggatgacgatttcctcgac
aaggcgctcgaaggctttgcgatgtttgccttgaaccagggcgaagtctgcacctgcccg
agccgcgccctcgtccaggaatcgatctatgaccgcttcatggaaaaggccgtcaaacgc
gtcgaagcgatcaagcagggcaatccgctcgacagcgcgacgatgatcggcgcccaggcc
tcgacggagcagctggaaaagatcctcgcctatctcgacatcggcaagcaagaaggcgcc
gaggtgctgaccggcggcacgcgcaacgatctcggcggcgacctggcgaacggctactac
gtcaagccgacgatcttcaagggtcacaacaagatgcgtgtgttccaggaggagatcttc
gggccggtggtttcggtcacgactttcaagaacgagaaggaagcgctcgaaatcgccaac
gacacgctctacggcctcggcgccggcgtctggagccgcgacgccaatcgctgctaccgc
ttcggccgcgagatccaggccggccgcgtctggaccaattgctaccacgcctacccggcc
catgccgccttcggcggctacaagcagtccggtatcggccgtgaaacccacaagatgatg
ctcgagcactaccagcagaccaagaacatgctggtgagctacagcccgaaggcgctcggc
ttcttctga

DBGET integrated database retrieval system