KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0344Help
Entry
Rmag_0344         CDS       T00438                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
rma00970  Aminoacyl-tRNA biosynthesis
rma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rma00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rmag_0344
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rma03029]
    Rmag_0344
Enzymes [BR:rma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Rmag_0344
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Rmag_0344
Mitochondrial biogenesis [BR:rma03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Rmag_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABL02120
UniProt: A1AW13
LinkDB All DBs
Position
370329..371771
Genome map
AA seq 480 aa AA seqDB search
MHTKTIVELAQGFKDKDFSCVELTQYYLNRIDQSDLNAFITVTDELALAQAQVADDKIAS
GNANILTGIPYAHKDIFCTKGVKTSAGSRMLDTFVSPYDATVSQKLNQVNLVMLGKTNMD
EFAMGSSNENSFYGAVKNPWNYLKIPGGSSGGSAASVAGGLSCFATGTDTGGSIRQPASL
CGITGIKPTYGRISRYGMIAYASSLDQAGPMTKTAQDAAIVLNVMAGFDEKDSTSVEQKV
PDYTTHLNDSIKGLIIGLPKEFFSSGLDDEVANNIMAAVKEFEAMGAIVKEVSLPNLAYA
IPVYYIVAPCECSSNLSRLDGVRYGYRAKNVKNLEDLYLRSRSEGFGEEVKRRIMIGAYA
LSAGYYDAYYLKAQKVRHLISDDFKKVFEQIDVIMGPVSPTTAFDLGSVKDPVSMYLADI
YTLSANLAGLPGMSIPAGFAQNLPVGLQLIGNFWSESRLLNIAHQFQLQTDWHLKTPQEC
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaaaactattgttgaattagcacaaggctttaaagataaagatttttcttgt
gttgaattaacgcagtattatttaaatcgcattgatcagtcagatttgaatgcttttatt
acagtaactgacgaattagcattagcccaagcccaagtagcagatgataaaattgcttca
ggtaatgcaaatatattaacaggtattccatacgctcataaagatatcttttgtaccaag
ggtgtaaaaacctcagcaggctctagaatgttagatacttttgtatcgccttatgatgca
accgtaagtcaaaaacttaatcaagtaaatttagtgatgttgggtaagactaacatggat
gaatttgccatggggtctagcaatgaaaactcgttttatggtgcggttaaaaatccgtgg
aactacttaaaaataccaggaggttcatcaggcggttctgcggcgagtgttgctggcggg
ttaagctgttttgctacaggtacagatacaggtggctctattcgtcagcctgcaagttta
tgtggtattacaggcattaaacctacttatggccgaatatcaagatatggcatgattgct
tatgcatcaagtcttgaccaagcaggaccgatgactaaaacagcacaagatgcagctatt
gtgttaaatgttatggctggatttgatgaaaaagactcaaccagtgttgagcaaaaagtg
ccagattatacgactcatcttaatgattcgattaaggggttaatcattggactgccaaag
gagtttttttcatctggattggatgatgaagtggctaataatattatggctgctgttaaa
gagtttgaagccatgggcgcaattgttaaagaggtatcgttacctaatttagcctatgct
attccagtttattacattgttgctccttgtgaatgttcatcaaatttatcgcgtctagat
ggtgttagatatggatatcgtgctaaaaatgtaaaaaacttagaagatttatatttgcgt
tcgcgctcagaaggctttggtgaagaggttaaacgtcgtattatgatcggtgcttatgct
ttatcagcgggttattatgatgcttattatcttaaggcgcagaaagtacgccatttgatt
agtgatgattttaaaaaagtatttgagcagattgatgtgattatggggccagtttcccct
acaactgcatttgatttaggttcagttaaagacccggtttctatgtatttggcagatatt
tatacactcagtgccaacttagcaggcttgccaggtatgagtattccagcaggttttgcg
caaaatttaccagtagggttgcaacttattggtaacttttggtcagaatctaggttactt
aatattgcacaccaattccaattacaaactgactggcacttaaaaacaccacaggagtgc
tag

DBGET integrated database retrieval system