KEGG   Epibacterium mobile: K529_018210Help
Entry
K529_018210       CDS       T04367                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rmb  Epibacterium mobile
Pathway
rmb00061  Fatty acid biosynthesis
rmb00780  Biotin metabolism
rmb01100  Metabolic pathways
rmb01130  Biosynthesis of antibiotics
rmb01212  Fatty acid metabolism
Module
rmb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rmb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    K529_018210
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    K529_018210
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    K529_018210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rmb01004]
    K529_018210
Enzymes [BR:rmb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     K529_018210
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     K529_018210
Lipid biosynthesis proteins [BR:rmb01004]
 Fatty acid synthase
  Component type
   K529_018210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ANP42698
UniProt: A0A1B1A845
LinkDB All DBs
Position
unnamed1:574266..575060
Genome map
AA seq 264 aa AA seqDB search
MTGVLAGKRGLIMGVANDRSIAWGIAKAMHEAGAELAFTYQGEAFGKRLEPLAASVGSDF
MVDVDVTDDASLDTAFEQLSARWPTIDFLVHAIAYSDKTELTGRFINTSRANFKNSMDIS
AYSFIEVARRAYPLMQENGGGTMMTLTYGGSNRVTPNYNVMGVAKAALESATRYLANDLG
PDGIRVNAISPGPMKTLAGAAIGGARKTYKHTEQNAPLRSNATLEAVGGTAVYLASDAGA
YTTGEIIRVDGGFHILGMPQQEHL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgacaggagtattggccggcaaacggggcctgatcatgggggtggcaaacgaccgctcc
atcgcctgggggatcgccaaggcgatgcatgaggcaggggccgagctggcctttacctat
cagggtgaagcctttggcaaacgtctggagccgctcgcggcctctgtaggcagcgatttc
atggtggatgtggatgtcaccgatgatgcctcgctcgacaccgcgttcgaacagctgagc
gcgcgctggccgacgattgatttcctcgttcacgcgattgcctattcggacaagaccgaa
ctcaccggccggttcatcaacaccagccgcgcgaacttcaagaactccatggatatctcc
gcctattccttcatcgaggtggcgcggcgcgcctatccgttgatgcaggaaaacggcggc
ggcaccatgatgacgctgacctatggtggctccaaccgggtgacgccgaactacaatgtg
atgggtgtggccaaggccgcgctggaaagcgccacgcgctatctggccaatgacctcggc
cccgatggcatccgcgtcaatgcgatctctcccggcccgatgaaaacgctcgccggggct
gcgatcggtggtgcgcgcaagacctacaagcacaccgagcagaacgcccccttgcggtcc
aatgcgacccttgaagcggtgggcggcacagcggtctatctggcctcggacgcaggagcc
tacaccacgggtgagatcatccgcgtcgatggcggctttcacatccttggtatgccgcaa
caagaacacctctga

DBGET integrated database retrieval system