KEGG   Epibacterium mobile: K529_021075Help
Entry
K529_021075       CDS       T04367                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rmb  Epibacterium mobile
Pathway
rmb00250  Alanine, aspartate and glutamate metabolism
rmb00410  beta-Alanine metabolism
rmb00640  Propanoate metabolism
rmb00650  Butanoate metabolism
rmb01100  Metabolic pathways
rmb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    K529_021075
   00650 Butanoate metabolism
    K529_021075
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    K529_021075
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    K529_021075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rmb01007]
    K529_021075
Enzymes [BR:rmb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     K529_021075
Amino acid related enzymes [BR:rmb01007]
 Aminotransferase (transaminase)
  Class III
   K529_021075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ANP43251
UniProt: A0A1B1A9M6
LinkDB All DBs
Position
unnamed1:complement(1178767..1180044)
Genome map
AA seq 425 aa AA seqDB search
MLNAEISSRRDAAISRGVGMQTQVYVSRASGAEVWDVEGRRYIDFAAGIAVVNTGHCHPK
VMEAVRAQSEAFTHTCHQVLPYENYIRLAERLNDKVPGNFDKKTVFVTTGAEAVENAIKI
ARAATGRSAIIAFGGGFHGRTFMGMSLTGKVAPYKKGFGAMMPDVFHVPFPADLHGISTS
DALTAIEKLFKADLDPDRVAAIILEPVQGEGGFYPAPTELMRGLRELCDSHGILLIADEV
QTGFARTGHLFAMEGYDVAADITTMAKGLAGGLPLAAVTGRAEIMDAAAPGGLGGTYGGN
PLGIAAAHAVLDIIEEEDLCDRANELGSRLKQRLSAIRETVPEIADIRGPGFMVAAEFYS
ADGSAPNPDMANAIRAEALNRGLVLLTCGVYGNVIRFLAPLTIPDGVFSEALDILEASIS
AVKGA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatgccgaaatttccagccgtcgcgacgccgctatatcccggggcgtcggcatg
caaacgcaggtctatgtctcccgtgcgagcggtgccgaagtctgggatgtggaaggacgc
cgctatattgatttcgctgctggaattgccgtggtgaataccggccattgtcacccaaag
gtgatggaggccgtgcgcgcacaaagcgaggcatttacccacacctgccatcaggtcctg
ccatatgaaaactacattcggctggccgaacgcctgaacgacaaggtgccgggcaatttt
gacaaaaagaccgtttttgtcaccaccggagccgaggccgtcgagaacgcgatcaaaatc
gcgcgtgccgcaaccggacgatctgccatcatcgcctttggcggcgggttccacggtcgc
accttcatgggaatgagcctcaccggcaaggttgccccctataagaaagggttcggtgcg
atgatgcccgatgtctttcacgtccccttccctgccgatcttcatgggatctcaacatcc
gatgcgctgacggcgatcgaaaagctatttaaagcagacctcgatcctgatcgcgtcgcc
gcaattattctggagcctgtccagggtgagggtgggttttatcccgcaccgactgagctg
atgcgcggcttgcgcgaactttgcgactcccatggcattttgttgatcgcagatgaggtc
cagaccgggtttgcccgcaccgggcatctctttgcgatggaaggctatgatgtggctgcg
gacatcaccacaatggcaaagggtctggccggtggtctgccacttgcagctgtgaccgga
cgcgctgaaatcatggacgccgccgcgcccggcggcttgggtggcacctatggcggcaac
cctttgggcattgccgcagcgcatgcggtcttggatatcatcgaagaagaagacctgtgt
gacagggcaaatgaactcggttcgcggctcaagcaacgtctcagcgcgatccgcgaaaca
gtgcccgaaatcgctgacatacgcggccccggtttcatggttgcggcagagttttattcg
gcggatgggtctgcaccgaacccggatatggccaatgcaatccgtgccgaggccctgaac
cgggggctggttttgctgacctgcggtgtctacggcaacgtaatccgtttcctcgctccg
ctaaccattcccgatggcgtgttttctgaggctctcgacattctcgaggcatcaatctct
gccgtgaagggagcctga

DBGET integrated database retrieval system