KEGG   Rickettsia monacensis: RMONA_06085Help
Entry
RMONA_06085       CDS       T03824                                 

Gene name
ftsI
Definition
(GenBank) Peptidoglycan synthase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
rmc  Rickettsia monacensis
Pathway
rmc00550  Peptidoglycan biosynthesis
rmc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rmc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RMONA_06085 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    RMONA_06085 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rmc01011]
    RMONA_06085 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rmc03036]
    RMONA_06085 (ftsI)
Enzymes [BR:rmc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     RMONA_06085 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:rmc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   RMONA_06085 (ftsI)
Chromosome and associated proteins [BR:rmc03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    RMONA_06085 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: CEO17576
UniProt: A0A0B7J0H4
LinkDB All DBs
Position
970239..971921
Genome map
AA seq 560 aa AA seqDB search
MKQILEKWKPAIKSLIIWNVCRNTKIRLLMVICGFSFLFCTLSYRLIIVATNVYDKNQNS
FKKNHQFRKEIVDRNGNLLAVNLPSASLFANPQIVLDPETSVKKLAEILPDINKAKLLAE
LKSNKSFIWVKRDLLPSQQEKITSLGLLGFEFEEEQKRIYTFSNLLSHVVGYVGRDSVGL
SGLELAYDKYLTNSDYELNEPKNQKEPLQLSIDIRLQSILSEEIDKTLKQFKAIGAVGII
ADPNNGEILALVNKPDFDPHHPSLAKPEELFNIASLGIYEMGSVFKALTMAVGFDTGAIN
MNDAYDISYMKVGGFQLKDYTPRQGWHSVPEIFLYSSNIGTSQIMLEIGKSNFKKYLKKL
GLLDQLQIELPERGTPLFPSEKRWNELTSVTMSYGYGISISPLHFVRAMLPVVNGGTLYD
LTLLKRKDKKVIGTKVFSENTSTQMKKLFRSVVKEGNGKRAEVKGYLIGGKTGTAEKLSQ
GAGGKKKYLKNSRASSFLGVLPASNPQYVIFIRFDEPKPTKESFGFATASWTAAPTAGRV
FERMISLYGLEPIEQSEEEN
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaattttggaaaaatggaaacctgcaattaaaagtctgataatttggaatgtt
tgtagaaatacaaaaatccgattattaatggttatttgtggcttttcttttcttttttgt
actttatcttaccggttaataatcgttgctacaaatgtttacgataaaaaccaaaattct
tttaaaaaaaatcatcaatttagaaaagaaatagttgatcgaaacggtaatttattagcc
gttaacctaccttcagcatcattatttgctaatccacaaatagtacttgatcctgaaact
tccgtaaaaaagctagcagaaattttgcctgatattaataaggctaaattacttgcagaa
cttaagtcaaataaaagctttatatgggtaaaaagagatttattacctagtcagcaagaa
aagataactagccttgggttacttggttttgaatttgaagaagagcagaaacgaatttat
acattttctaatttattgtcgcatgttgtcggttatgtaggtagagattcggtagggctt
agtggcttagaactcgcttacgataaatatttaactaattctgattatgaattaaacgaa
ccaaagaatcagaaagaaccacttcaattatctattgatatcagattacaaagtatttta
agtgaagagattgataaaactttaaagcaatttaaggctataggagcagtaggtattatt
gccgatccaaataacggcgagattttagcattagtaaataagcctgatttcgatcctcat
catccgagtttagcaaaaccggaagagttgtttaatatagcaagtctcggcatttacgaa
atgggttcggtatttaaggcattaactatggcagtcggttttgataccggtgcaataaat
atgaatgatgcttatgatataagctatatgaaagtaggaggattccagcttaaggattat
acgccaaggcaagggtggcatagtgtacctgagatttttctatattcttcaaatattggc
acaagtcaaattatgcttgaaatcggtaaaagcaattttaaaaaatatctaaaaaaatta
ggtttattagatcagttacaaatagaattacctgaacgaggtactccgttatttccttcc
gagaaaagatggaatgagttaactagtgttactatgtcgtacggctacggcatttcgatt
agtcctttgcattttgttagagcaatgttaccggttgttaacggcggtactttatatgat
cttactttattaaaaagaaaagataaaaaagtaataggtacaaaagtttttagtgaaaat
acctctacccaaatgaagaaattatttagatcggtagtaaaagaaggtaacggtaaaaga
gcagaggtcaaaggctatcttatcggtggtaagaccggtacggcagaaaaactttcacaa
ggtgcagggggtaaaaagaaatatctaaaaaatagtagagcttcatcgtttttaggagtg
ctacctgcatctaacccgcaatatgttatttttattagatttgatgaaccaaagcccact
aaagaaagctttggctttgcaacggcgagctggacggctgcccctactgccggtagagtg
tttgaacgtatgatatctttatatggtttagagccgatagaacaaagtgaagaggaaaat
taa

DBGET integrated database retrieval system