KEGG   Rhopalosiphum maidis (corn leaf aphid): 113551575
Entry
113551575         CDS       T06065                                 

Definition
(RefSeq) prostaglandin D2 receptor-like
  KO
K04332  prostaglandin D2 receptor
Organism
rmd  Rhopalosiphum maidis (corn leaf aphid)
Pathway
rmd04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rmd00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113551575
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rmd04030]
    113551575
G protein-coupled receptors [BR:rmd04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    113551575
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7tm_4 zf-UBR
Other DBs
NCBI-GeneID: 113551575
NCBI-ProteinID: XP_026809683
LinkDB
Position
2
AA seq 358 aa
MELAVTNATASSSPATLVLPVQAGGRLQSPGVQLGVTGLYGFGIFGNLLALFILHRTRSS
SNQKHGFMLRCLATNDCIALAGMLIQMFVSVQWPSTKNNVWSCRIRVLWRFFGLGSGCVA
IVMAVERWLALTKPFFYQKHISLRLLKRMMVILWLGVLCLVCAPYFGFGLYWDEKSLTCV
RYRNAKKPLDVLYAYLYFGHGVFLCFAIVYTNLAVMKALCMKDSPHNKHNVLMRRISRGS
SLTCNAATKEERAFGWLMFLLCVAFVTCWVPQMISIPLSRFIEDETKIRPFTMAADMLLA
MHFALDPYLYVLQHWTLVKSICLRPKNKKNANGGSTSVSRSSSMRTTCFSWFTWPVFH
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggagctggccgtgacgaacgcgaccgcgtcgtcgtcgcccgcgacgctggtgcttccg
gtccaggccggcggtcgattgcagagtcccggcgtgcaattgggtgttaccgggctgtac
gggttcggaatattcggcaacctgctggcgcttttcatactacaccggacccggtcgagc
agcaaccagaagcacgggttcatgttgcggtgcttggccaccaacgattgcatcgcgctc
gctggcatgttgatccagatgttcgttagcgtccaatggccgagcaccaagaacaacgtg
tggtcgtgccggatccgcgtcctgtggcggttcttcgggctgggctcagggtgcgtggcc
atcgtgatggccgtcgaacgctggttggcgctcaccaaaccgtttttttaccaaaagcat
attagccttcgtctactcaaacgaatgatggtcatactttggttaggagtactgtgttta
gtgtgcgcaccatacttcggatttggtctctactgggatgagaaatcgttgacgtgtgta
cgttaccggaatgccaagaagcctttggatgtgttatacgcttacttatatttcggtcat
ggtgtatttttatgctttgcaatagtctacacgaacttagccgtaatgaaagctctgtgt
atgaaggacagtcctcacaacaagcacaacgtgttaatgagacgcatcagtcgaggatcg
tcattaacttgcaacgctgctaccaaagaagaaagagcgttcggttggctcatgtttttg
ctgtgcgtcgcgtttgttacatgttgggtcccgcaaatgatatcgataccgttatccagg
ttcatcgaggatgagacaaagattcgaccgttcaccatggctgcagacatgcttctggct
atgcacttcgcactggacccgtatctatacgtgctccagcactggacgttagtaaagtcc
atctgcttgcgaccgaagaacaaaaaaaatgccaacggtggcagcacgagcgtgagtcgc
agcagttccatgagaacaacatgtttctcgtggttcacatggccagtgtttcattga

DBGET integrated database retrieval system