KEGG   Rhopalosiphum maidis (corn leaf aphid): 113552822Help
Entry
113552822         CDS       T06065                                 

Definition
(RefSeq) lysophosphatidylcholine acyltransferase isoform X1
  KO
K13510  lysophosphatidylcholine acyltransferase / lyso-PAF acetyltransferase [EC:2.3.1.23 2.3.1.67]
Organism
rmd  Rhopalosiphum maidis (corn leaf aphid)
Pathway
rmd00564  Glycerophospholipid metabolism
rmd00565  Ether lipid metabolism
rmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    113552822
   00565 Ether lipid metabolism
    113552822
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rmd01004]
    113552822
Enzymes [BR:rmd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     113552822
    2.3.1.67  1-alkylglycerophosphocholine O-acetyltransferase
     113552822
Lipid biosynthesis proteins [BR:rmd01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   113552822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-GeneID: 113552822
NCBI-ProteinID: XP_026811568
LinkDB All DBs
Position
2
AA seq 565 aa AA seqDB search
MFIVLVFYLACFIFSLFLVVYYDYPAVNYIVLLYRGKEDQDATAATSATEMSSETKLLIG
SDMIASKDILNPFVHHLELTSTYDKFKTAFFTIVVLPIRIVAILVLLFIAWLLATIGLAG
VSQTELSERPLTGWRRYVRRAVYVIVRLMFGAVGFHRVRTVGEQATRQQAPVLAVAPHSS
FYDGLAAVVTGGPTIVAKEENSFIPIVGRVINFTQPVYVRRDDPESRHNTIQEIIRRVKS
DQDWPQILIFPEGTCTNRSCLITFKPGAFYPAVPVQPVLLRYPNKLDTVTWTWDGPGALK
LLWLTMTQPTTTVEVEFLPVYVPSEYEKQNPKAFAEGVRNVMAKALAVPTADYTYDDCRV
AVKAGQLGLPMTSNLITVERLRSRLGLTRIKIEDSALVKNMLSFQNRESQPVDLAEFANN
LNVTAEDGSLISLFKMHLENEHLSTIDFKKYLLAEYILQKATSKDDLIVLAFKLYGEYFD
KEMFEYVLNLVYNLPKSEASIIYNEMTDKPNEINLSDYLHYGKKYPEKMESLQNHSKNTA
PRTVTDFSSCGQLFHDAIDDNKKYQ
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgttttagttttctatttagcttgttttatatttagtttgtttttagttgtg
tattatgattatcccgcggtgaattatatagtgttactgtaccgcggaaaagaagatcaa
gacgcgacagctgccacctccgctacagagatgagcagcgagacaaaactgttgattggc
agcgatatgatcgcatccaaagacatactcaaccctttcgtacaccatctggagctgact
tccacctacgacaaatttaaaactgcatttttcaccatagttgttctacccattaggata
gtggcaattttggtgttgctgtttatagcttggttgttagcgaccattggtttggccggt
gttagtcagaccgaattatcagagaggccacttaccggatggagacgctatgtcagacgt
gcagtgtacgtgatcgtccggcttatgttcggggcggtcggcttccaccgggtcagaact
gttggcgaacaggccacgcggcaacaggcgcccgtgctggctgtcgcgccacattcgtcc
ttttacgacgggctggcggccgtcgtcactggtggcccaaccatcgtagctaaggaagag
aactcgttcataccgatcgtaggaagagtaataaacttcacgcagcctgtgtacgttcgg
agagacgacccagaatcgagacataacacaatacaggagataattcgccgtgtaaaatct
gaccaagattggcctcagattttaatattcccggaaggcacttgtacaaaccgatcgtgt
ctgataacgttcaaaccaggtgctttttatccggcagtgcccgttcaaccagtgctgttg
cggtacccaaataaactagacaccgtcacctggacttgggacggtcctggagcattgaaa
ctcttgtggttaactatgacgcaaccgactacgacagtggaagtagaatttctaccggtg
tacgtacccagtgaatacgaaaaacagaacccaaaagcgttcgccgaaggtgttcgtaat
gttatggctaaggcattggctgttccaactgcagactacacatacgacgactgtagagtg
gctgtaaaagccggtcaattgggtctgccgatgacctcgaatttgatcactgtcgaaaga
cttagaagtcgactaggattgacgcgaattaagatcgaagattcggctctagtcaagaac
atgctgtcgtttcagaatcgagagtctcagccggtagatttggcagagttcgctaacaat
ttaaacgtcactgccgaggatggttcactcatcagcctctttaaaatgcatctagagaat
gaacacttgtcgaccatagattttaaaaagtatttgttggctgaatatatcttacagaaa
gctacctccaaagacgatttgatcgtattggcttttaagttgtatggtgaatattttgat
aaagaaatgtttgagtatgtgttaaatcttgtctacaatcttccaaaatctgaagcatca
atcatttacaacgaaatgaccgacaagccaaatgaaataaatttgtcggactatttacat
tacgggaaaaagtatcctgaaaaaatggagtccttgcaaaatcacagtaagaatacagca
cccagaacagtaacagatttttctagttgcggccaattattccatgacgctatagatgac
aacaagaagtatcaatga

DBGET integrated database retrieval system