KEGG   Rhopalosiphum maidis (corn leaf aphid): 113555292Help
Entry
113555292         CDS       T06065                                 

Definition
(RefSeq) tyrosine-protein kinase hopscotch
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
rmd  Rhopalosiphum maidis (corn leaf aphid)
Pathway
rmd04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:rmd00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113555292
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rmd01001]
    113555292
Enzymes [BR:rmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     113555292
Protein kinases [BR:rmd01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   113555292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 FERM_F1 Jak1_Phl FERM_F2 Mlp
Motif
Other DBs
NCBI-GeneID: 113555292
NCBI-ProteinID: XP_026815515
LinkDB All DBs
Position
2
AA seq 1124 aa AA seqDB search
MMDSSISIKVHVAVQSTPHEIPVTINTTVEDVIIETSKLLNIGPVARHLFGLRVLSVTDD
NLWLSPSLFILYAKNEHHVYEYKLRYKMPDVKRLKSIDCYAYNFYFYQVKFDLLKSKVTG
LCYDTCKRELIGMGVADMYRSMLEEDKSRETVEQNYKHFMPQEVVKQHMFFLKKPVQETL
KILINNNTIGTLYVPVIKESYLEQFNSIAPDYLEEEYKALYSENGSSVNVAFRVNPFHSE
MPGIRMCTENRKEWVHLAAIEDLCFLSTTDDGTVEISRKTGIPIHLKFLSTSTMFSFITL
LNGYYRLMVNWNFDLCVSTNTPSLSKLKSIRCHGPISIMKSTSILKKKMSKKHGSFILRQ
SMKNYDNYVIDVCINQSMKPMTYVIESKGGFYKLAGDDKIEYPSIWRLITNNKMSLNFIE
CIFPSDIAMNELLLCQNTSIKHDIGNDDEDDKVTGPHLINSDSIHLLKTICSPKKKMQSL
MKVRVATWCKSKRNESTVVVKLFQDDVNINLHLMDLLSLSKRWSSVSSSAIVRLFGLCVD
TPTALVSEYFALGPLDTYLRTNKDNILFSNLVEAATYIATALWDMETACLVHGKIRCHKF
VVAEHTKNSFIVKLTDPGIHKCYTNYDLYWIPTEFYNTMELARKSPQADIWAFSSTLWEL
FNYGFILPDVQNVEFFKKKFEKNIRMPKPECCTDDIYHIMTDCWDSDPFIRKKPQATLRD
LRQIWLQIYASPQHEYTPLKKEEIYCDDVTCSDATIYCTSDYTIETFLDTVSSSFSSSET
KSDFIDFNSNPDDARSYQNENPMIAATNTSFNQFMEQLTSKEEIKNNLQSAMNCQKKTYQ
FNNATLTLQQVIGQGFYGVVLEGLLKCSDNTTKKVAVKHMKRSFQTEDFQREIGIIEGLS
HPNIVEIEGVLEEPNLMLVMEYIELGSLSSYLRLHEDELVEETNRLLKYALDIAQGMEYL
GSLNIIHRDLATRNILVSSPTTVKISDFGLAQFLPDEKYYYLQTMRDLPLKWHAPEAILY
GKFSPKTDIWAYGVLLFEIFSLGKEPNVVSKLEERLDVEKLIRVLEEGHRLQCPSCPPCT
IDIYNKLMRPCWAYVAGDRPNFSDLINNIKSLMSIEPAEYFTRG
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgatggattcgtccatttcgatcaaagtacacgtagctgtccaatcgactcctcacgag
atacctgtcaccatcaacacgactgtggaagatgtaattatagagacctcgaagctatta
aacattggcccggtggccagacatttatttggactgagagtcttgagcgttactgacgac
aacctgtggttgagcccctctttgtttatattatatgctaaaaatgaacatcacgtttat
gagtacaagttgaggtataaaatgcctgatgtcaaacgactcaagtcaattgattgttat
gcttataatttctatttttatcaagttaaatttgatctgttgaagagtaaagtaactgga
ttgtgctatgacacatgcaaacgagagctcattggcatgggtgttgctgacatgtataga
tccatgttagaagaagacaaatctagagaaactgtcgaacaaaattataaacactttatg
ccccaagaagtagttaagcaacacatgttttttttgaagaaacctgtccaagaaacttta
aaaatacttataaataacaatacaattggtactctttatgtacctgttattaaagaaagt
tatttagaacaatttaattctattgcaccagattatttagaagaagaatataaagctcta
tacagtgaaaacggcagttctgttaatgttgcatttagggtaaatccatttcattctgaa
atgcctggtataagaatgtgtactgaaaacaggaaagaatgggtacatttggcagctatt
gaagacttgtgttttctatcaactactgatgatggtactgttgaaatatctagaaagact
ggcatacctattcatttgaaattcttaagtacaagtacaatgttttcatttataacatta
ctgaatggttattatcgtttaatggttaattggaattttgatttgtgcgtatctactaat
actccatctttgagtaaacttaaatcaattcgttgtcatggaccaatcagcataatgaaa
tctacttctatcttgaaaaaaaaaatgtcaaagaaacatggaagttttatacttagacaa
agcatgaagaattatgataactatgttattgatgtctgtatcaatcagagcatgaagcca
atgacatatgtaatagaaagtaagggtggattttataagcttgctggtgatgataaaata
gaatatccttctatttggagacttataactaacaataaaatgtctttgaacttcattgaa
tgcatttttccatcagatattgctatgaatgaactattattatgtcaaaatactagtatt
aaacatgatataggtaatgacgatgaagatgataaagtcactggtcctcatttaattaat
agtgactctatacatctattaaaaactatttgttcaccaaaaaaaaaaatgcaatcactt
atgaaagttcgagtggctacatggtgcaaatctaaaagaaatgagtccactgttgttgtt
aaattatttcaggatgatgttaacataaatttacatttaatggatttgttaagtttatca
aaaagatggagttctgtgtcttcaagtgctattgtaagattatttggtctatgtgttgat
acaccaactgccttagtcagtgaatattttgcattaggacctcttgatacatatctgaga
accaataaagataatatattatttagcaatttagttgaagctgcaacatatatagctacg
gcattatgggatatggaaactgcatgtttagttcatgggaaaattcgatgtcataaattt
gtagtagctgaacataccaaaaattcctttatcgttaaacttacagatccaggcattcat
aaatgttataccaactatgatttgtattggattccaacagaattttataacactatggaa
cttgctcgaaaatctcctcaagctgatatttgggcttttagttcaacgttatgggagcta
tttaactatggttttatattacctgatgttcaaaatgttgagttctttaaaaaaaaattt
gaaaaaaatataaggatgccaaaaccagaatgttgtacagatgacatataccacataatg
actgattgttgggacagtgacccttttataagaaaaaaaccacaagcaaccttaagagat
ttaagacaaatttggcttcaaatttatgctagtcctcaacatgaatatacaccattaaaa
aaagaagaaatatactgtgatgatgtcacttgctctgatgcaacaatttattgtacttcg
gattacacaatcgaaacatttttggatactgtatcaagctctttttccagtagtgaaaca
aaatcagattttattgattttaattctaaccctgatgacgcaagaagttatcaaaatgaa
aatcctatgattgcagctactaacacaagtttcaatcaattcatggaacagcttacatca
aaagaagagataaagaacaatttgcaaagtgctatgaactgccaaaagaaaacatatcaa
ttcaataatgctacattaactttacagcaagttattggacaaggattttatggagttgta
ttagaaggattgttaaaatgcagtgataatacaaccaaaaaagtagctgtgaaacatatg
aaaagatcatttcaaactgaagattttcaaagagaaattggaattatagagggacttagc
catccaaatattgttgaaattgagggtgtattagaagaaccaaatttaatgctcgtaatg
gaatatattgaacttggttcattaagtagttacttgcgattacatgaagatgaactagtg
gaggaaactaatagattattgaaatatgctttggacattgcccaaggaatggaatactta
ggaagtctaaatataatacatcgggatttagctacaaggaatattttggtatcaagccca
acaactgttaaaatttctgattttggcttagctcagtttttacccgatgaaaaatactat
tacttacaaacgatgcgagatttgcctttgaaatggcatgctccagaggctattttgtat
gggaaattttctccaaaaactgatatttgggcatatggtgtattactttttgaaattttt
tctttgggtaaagaacctaatgtagtctctaaattagaagaaagactagatgttgaaaaa
ctaataagagttttggaagaaggtcatcggttacaatgtccatcatgtccaccttgcacc
atagacatatataacaaacttatgcggccttgttgggcttatgtagcaggcgatcgtcca
aatttctcagatttaataaataatattaaatcattaatgtctattgaacctgctgaatat
tttacacgtggataa

DBGET integrated database retrieval system