KEGG   Rhopalosiphum maidis (corn leaf aphid): 113555842
Entry
113555842         CDS       T06065                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
rmd  Rhopalosiphum maidis (corn leaf aphid)
Pathway
rmd00230  Purine metabolism
rmd01100  Metabolic pathways
rmd04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:rmd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113555842
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    113555842
Enzymes [BR:rmd01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     113555842
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA
Other DBs
NCBI-GeneID: 113555842
NCBI-ProteinID: XP_026816206
LinkDB
Position
3
AA seq 1037 aa
MESTPKPTSAAGGGSSSTPNAGRFADKATESLYQSYNAKQKRAAFACYVSASVLFDVYCL
SVYDARSPWTWCLLATNVVTLLWCRLAGGRRQYWTAVAHLAWLTADVQVVFHMVANAAEG
ADLLGWILLYDYLAYVSLPLTLALCIALSATTCVTYVLTMAVLGRQHAYLARQLATNSVL
LLASNCLGLLSYFLADKQQRTAFLETRQCLEMKMVIEEQSTEQERLLLSVLPEHVAVKMR
QDLGEALDSQFKKIYMSRHENVSILYADIVGFTAISSTYSASDLVKILNELFARFDRLSE
KYQQLRIKILGDCYYCISGAPKERPDHAVLSVHMGLSMVKAIKYVQQTTNSPVDMRVGIH
TGAVLAGVLGQRQWQFDVYSKDVELANKMESSGMPGRVHISEKTLSFLNGEFEVEPGYGE
RREEALKMASIKTFFIIKTIKPFKMDVQNGSLTDQNSASKESVCATPIDDADLIAQAKED
SDNFKKRLRKDLMNRDGHRDLNKHTKFFTLAFNDEAKEREYKYHKEAASGVSLIGCPLVL
FLTSSAQIIMLPRDILSYMSSCLALVLLLIIVVVSVADIFPRILPSKIVWFSETINDSLW
IRRILGITAASLLASTNLVGLVSCWSDKQILTNCTHGQNDPSTYCMYPSYFTYFMVLALI
ATSMLTQLSHFTKATILFVITLMHCVVNIVTVGTAIDCEDSIIYKPFKVLPSKYALSFLL
IAVTMALVFLARNMDKSSRVLYLWRTEVEEQRERASDIRRRNEALVYNILPPHVAKHFLG
SYKRQHEELYSQSYAEVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLEQ
PRYQDIIKIKTIGSTYMAASGLNPSRVVKPEDPIEVRWAHLALLVDFAFDLKKALQGINE
QSFNHFVLKMGINHGPITAGVIGARKPHYDIWGNSVNVASRMESTGKAGCIQVTEETCNI
LQHFGFKFEQRGLVAVKGKGQLMTYYLVGKGLQPSQAPPPIMETLPEVEEEDTDECMLVR
QALLPRTDHNGSATASG
NT seq 3114 nt   +upstreamnt  +downstreamnt
atggaatccacgccgaagcccacttcggcagccggcggcggctcgtcctcgacgccgaac
gccggacggttcgccgacaaggccaccgagagcctttaccagagctacaacgcgaagcag
aagcgcgcggccttcgcgtgctacgtgtccgcttccgtgctgttcgacgtgtactgcctg
tccgtgtacgacgcccggtcgccgtggacgtggtgcctgctggccaccaacgtggtcacg
ctgctgtggtgccggctggccggcggccggcgccagtactggacggccgtggcccacctg
gcctggctcacagccgacgtccaagtggtgttccacatggtggcaaacgcggccgagggc
gccgacctgctcggatggatcctgctctacgattacctggcctacgtgtccctgccgctc
acgctggccctgtgcatagccctcagcgccaccacgtgcgtcacctacgtgctcaccatg
gccgtgctgggccgtcaacacgcgtacctcgcccgacagttggccacgaacagcgttctc
ctcttggcgtccaattgtttgggacttttgtcctatttcctggccgacaagcagcagcgg
accgcctttctggaaacccggcaatgcctcgagatgaaaatggtcatagaagaacaatcg
accgagcaggaacggctgttgttgtccgtgttaccggaacacgttgccgtcaaaatgcgc
caggatttgggtgaggcgttggacagtcaattcaaaaagatatacatgagcaggcacgaa
aacgttagtatattgtatgctgacatcgttggattcacggcaatatcgtctacatactcg
gcttcggacctggtaaaaattctcaacgagctgttcgccagattcgatcgactgtccgag
aaataccaacaactcagaatcaagattttgggcgattgttactattgtattagcggcgct
cccaaggaacgacccgatcacgccgtgctcagcgtgcacatgggactctcgatggtcaaa
gctatcaaatacgtacagcagacgacgaattctccggtagacatgcgagtgggcatacac
acgggagccgttttggccggtgttctgggccagaggcagtggcagtttgacgtttactcc
aaggatgttgaattggcgaataaaatggaaagcagtggaatgccgggacgagtgcatata
tccgagaaaactctgagtttcttaaatggagagtttgaagtcgagcccggttacggcgaa
cgccgcgaagaagcgcttaagatggctagcataaaaactttcttcattataaaaacgatc
aaaccgttcaaaatggatgtgcaaaacggatcgctgactgatcagaacagtgctagtaaa
gaatctgtgtgtgcgacaccgattgatgacgccgatttaatagctcaggccaaagaagac
tctgataactttaagaagcgattaagaaaggacttgatgaacagagatggtcacagggat
ttaaacaaacatacaaaatttttcaccttggcatttaatgacgaagcaaaagaacgtgaa
tacaaataccacaaagaagctgcatctggtgtgtctcttataggttgtccgttagtactc
ttcttgacgtcttccgcacaaattattatgttacccagagatattttaagctacatgtcc
agttgtcttgcattagtattactattgattattgtagtagtatcagtcgctgacattttt
ccaagaattctgccatcaaaaattgtatggttcagtgagaccataaatgactctttatgg
attcgacgtatacttggcatcactgccgcgtcattgctagcatctaccaatcttgtggga
ctggtatcgtgttggtctgacaagcaaatactaaccaactgcacgcatggccaaaacgat
ccatcgacttactgtatgtatccatcatatttcacttacttcatggtgttggcgttaata
gctacgtccatgctgactcaattatctcatttcaccaaagcaactatactgttcgtcatt
actctgatgcattgcgttgtcaacattgttacagtaggcacagctattgactgcgaagat
tcaataatttacaagccattcaaagttttgccatcgaagtatgcattgtcgtttctactc
atagccgttacaatggcactggtgtttttggctagaaatatggacaaatcatcaagagtt
ctttatctatggcggacggaagttgaagaacagagagaaagggcttcagacatacggaga
agaaatgaagcattagtatacaatattttacctccgcacgtagccaaacatttcttaggt
agttataaacgtcagcacgaagaactatacagtcagagttatgccgaagttggagttttg
tttgcatcaatgccaaacttttcagatttctattcggaggagacggttaacaaccaaggc
ctggagtgcttaagatttctcaacgaagttatatctgattttgatgcgcttctggaacaa
ccgcgctaccaggatattattaagattaaaacaatcggttcaacttatatggctgctagt
ggattaaacccttcgcgtgtcgtaaagcccgaagaccccattgaagtcagatgggcacac
ctcgcattgctggtggactttgcttttgatctcaaaaaagcactccagggaataaatgaa
caaagctttaaccactttgtattgaaaatgggaatcaatcatggtccaataaccgcaggt
gttattggagcgagaaaacctcattacgatatttggggaaattctgtgaacgtggcgtcg
aggatggagagcactggaaaggctgggtgtatacaagtaacggaagaaacgtgtaatatc
ctgcaacatttcgggttcaagttcgaacagcgtggtctagtggccgtcaagggaaagggg
cagctgatgacctattatttggtgggcaaagggctccaacccagccaggcaccgccgccg
atcatggagacgctgccggaagtggaggaagaagacaccgacgagtgtatgttggtccgg
caggcgctgttgccccggaccgatcacaacgggtcggcaaccgcttccggttga

DBGET integrated database retrieval system