KEGG   Cupriavidus metallidurans: Rmet_1500Help
Entry
Rmet_1500         CDS       T00351                                 

Gene name
cbbS
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase/oxygenase, RuBisCO (type I) small subunit (CbbS)
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00630  Glyoxylate and dicarboxylate metabolism
rme00710  Carbon fixation in photosynthetic organisms
rme01100  Metabolic pathways
rme01120  Microbial metabolism in diverse environments
rme01200  Carbon metabolism
Module
rme_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rme_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:rme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rmet_1500 (cbbS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rmet_1500 (cbbS)
Enzymes [BR:rme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Rmet_1500 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABF08383
UniProt: Q1LN93
LinkDB All DBs
Position
complement(1620012..1620368)
Genome map
AA seq 118 aa AA seqDB search
MSDVMDYNSRLSDPASRKFETFSYLPAMDAASIKRQVEYLVKKGWNPAIEHIEPEYLMDS
YWYMWKLPMFGETDVDRVLAEAKACHKANPNNHVRLVGYDNFKQSQGAAMVVYRGKTV
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgtaatggattacaactcccgcctttccgaccccgccagccggaagttcgaa
actttttcctacctgcccgcgatggacgcggccagcatcaagaggcaggtcgagtatctg
gtgaagaagggctggaacccggctatcgagcatatcgagcctgagtacctgatggactcc
tactggtacatgtggaagttgccgatgttcggtgaaaccgacgtcgatcgcgttctggcc
gaggccaaagcctgccacaaggccaaccccaacaaccacgtgcgcctggtcggctacgac
aacttcaagcagtcgcaaggcgcggccatggtggtttaccgcggcaagacggtttaa

DBGET integrated database retrieval system