KEGG   Cupriavidus metallidurans: Rmet_1501Help
Entry
Rmet_1501         CDS       T00351                                 

Gene name
cbbL
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase/oxygenase, RuBisCo (type I) large subunit (CbbL)
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00630  Glyoxylate and dicarboxylate metabolism
rme00710  Carbon fixation in photosynthetic organisms
rme01100  Metabolic pathways
rme01120  Microbial metabolism in diverse environments
rme01200  Carbon metabolism
Module
rme_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rme_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rmet_1501 (cbbL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rmet_1501 (cbbL)
Enzymes [BR:rme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Rmet_1501 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABF08384
UniProt: Q1LN92
LinkDB All DBs
Position
complement(1620446..1621867)
Genome map
AA seq 473 aa AA seqDB search
MAAKTYNAGVKEYRQTYWTPEYTPKDTDLLACFKVTPQPGVAREEVAAAVAAESSTGTWT
TVWTDLLTDLDYYKGRAYRIEDVPGDDTCFYAFVAYPIDLFEEGSIVNVLTSLVGNVFGF
KALRALRLEDVRFPIAYVMTCGGPPHGIQVERDIMNKYGRPLLGCTIKPKLGLSAKNYGR
AVYECLRGGLDFTKDDENVNSQPFMRWKQRFDFVQEATEKAQRETGERKGHYLNVTAPTP
EEMYKRAEYAKEIGAPIIMHDYLTGGFCANTGLANWCRDNGMLLHIHRAMHAVLDRNPHH
GIHFRVLTKCLRLSGGDHLHSGTVVGKLEGDRDATLGWIDIMRDDFIKEDRSRGIMFDQD
FGSMPGVMPVASGGIHVWHMPALVTIFGDDSVLQFGGGTLGHPWGNAAGAAANRVALEAC
VEARNKGVAVEKEGKSILTEAATHSPELKIAMETWKEIKFEFDTVDKLDVAHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaaagacatacaacgctggcgtgaaggagtatcgccaaacctactggaccccg
gaatacactccgaaggacactgaccttctcgcctgcttcaaggtcaccccgcagccgggc
gtggcccgcgaggaagtcgccgccgccgtggccgccgagtcgtcgaccggcacctggacc
acggtgtggaccgacctgctgaccgacctcgactactacaagggccgtgcctaccggatc
gaggacgtgccgggagatgacacctgcttctacgccttcgtggcctatccgatcgacctg
ttcgaagagggttccatcgtcaacgtgctgacctccctggttggcaacgtcttcggcttc
aaggccctgcgtgccctgcgcctcgaggacgtgcgcttccccatcgcctacgtcatgacc
tgcggcggcccgccgcacggtatccaggtcgagcgcgacatcatgaacaaatacggccgg
ccgctgctgggctgcaccatcaagccgaagctcggcctgtcggccaagaactacggccgc
gccgtctatgagtgcctgcgtggcggcctcgacttcaccaaggacgacgagaacgtcaac
agccagcccttcatgcgctggaagcagcgtttcgacttcgtccaggaagcgaccgagaag
gcgcagcgcgaaaccggcgaacgcaagggccactacctgaacgtcaccgcgccgacgccg
gaagagatgtacaagcgcgccgagtacgccaaggaaatcggcgcgccgatcatcatgcac
gactacctgaccggcggcttctgcgccaataccggcctggccaactggtgccgcgacaac
ggcatgctgctgcacatccaccgcgccatgcacgccgtgctcgaccgcaacccgcaccac
ggcattcacttccgcgtgctgaccaagtgcctgcgcctgtccggcggcgaccacctgcac
tcgggcaccgtcgtcggcaagctggaaggcgaccgcgacgcgacgctcggctggatcgac
atcatgcgcgacgacttcatcaaggaagaccgcagccgcggcatcatgttcgaccaggac
ttcggctccatgcccggcgtcatgccggtcgcctccggcggcatccacgtctggcacatg
cctgccttggtcaccatcttcggcgacgactcggtgctgcagttcggtggcggtacgctc
ggccacccctggggcaacgccgccggcgccgccgccaaccgcgtcgcgctggaagcctgc
gtcgaggcgcgcaacaagggcgtcgccgtcgagaaggagggcaagagcatcctgaccgag
gctgccacgcactcgcccgaactgaagatcgccatggaaacgtggaaagagatcaagttc
gagttcgacaccgtcgacaagctggacgtcgcccacaagtaa

DBGET integrated database retrieval system