KEGG   Cupriavidus metallidurans: Rmet_1618Help
Entry
Rmet_1618         CDS       T00351                                 

Gene name
puuE
Definition
(GenBank) GABA aminotransferase, PLP-dependent
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00250  Alanine, aspartate and glutamate metabolism
rme00410  beta-Alanine metabolism
rme00640  Propanoate metabolism
rme00650  Butanoate metabolism
rme01100  Metabolic pathways
rme01120  Microbial metabolism in diverse environments
Module
rme_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Rmet_1618 (puuE)
   00650 Butanoate metabolism
    Rmet_1618 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rmet_1618 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rmet_1618 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rme01007]
    Rmet_1618 (puuE)
Enzymes [BR:rme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Rmet_1618 (puuE)
Amino acid related enzymes [BR:rme01007]
 Aminotransferase (transaminase)
  Class III
   Rmet_1618 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABF08501
UniProt: Q1LMX5
LinkDB All DBs
Position
1745040..1746302
Genome map
AA seq 420 aa AA seqDB search
MKNAELVRRKDAATPRGVGVMCNFYADRAENSEIWDVEGKRYIDFAAGIAVLNTGHRHPR
LVAALQAQLNRFTHTAYQIVPYASYVELAEKINQRAPGRSARKTAFFTTGAEAVENAVKI
ARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKTGFGPFPGEVFHAPYPSALHGVTVE
DSRRALEHLFKADIDPRRVAAIIFEPVQGEGGFNVAPPEFVRMLRAVCDEHGILLVADEV
QTGFGRTGKLFAMEHYDVAPDLTTMAKSLAGGMPLSAVCGRAEIMDAPAPGGLGGTYAGN
PLAVASALAVLDVLESENLIARGAELGERLTARLNSLKPRVPQIAEVRGIGAMVAVEFRR
ADGSPDAEFTREVQNRALERGLLLLSCGVYGNVIRFLFPLTIQDAVMNEGLDILADVLTR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacgccgaactggtccgtcgcaaggatgccgctaccccgcgtggggtaggtgtg
atgtgcaatttctacgccgaccgcgccgagaacagcgaaatctgggatgtcgagggcaag
cggtacatcgacttcgctgccggcatcgccgtgctcaacacgggccatcgtcacccgcgc
ctggtggccgcgctgcaggcgcaactgaatcgcttcacccatacggcgtaccagatcgtg
ccgtacgccagctatgtggagctggccgagaagatcaaccagcgcgcgccgggccgctca
gctcgcaagacggccttcttcacgaccggcgcggaagcggtggagaacgccgtcaagatc
gcgcgcgccgccaccggccggcccggcgtgatcgcgttctcaggcgggttccatggccgc
acgatgatgggcatggcgctgactggcaaggtggccccgtacaagaccggcttcgggccg
ttccccggcgaggtcttccacgcgccttacccgtctgcattgcatggcgtgacggtggag
gattcgcgccgcgcgctcgaacacctgttcaaggccgatatcgacccgcgccgcgtggca
gccatcatcttcgaaccggtgcagggcgaaggcggcttcaacgtggcgccgccggagttc
gtgcggatgctgcgcgctgtgtgcgacgagcacggcatcctgctggtggccgatgaggtc
cagaccggtttcggccgcacgggcaagctgttcgcgatggagcactacgacgtcgcgccg
gacctgaccacgatggccaagagcctggccggcgggatgccgctttccgccgtgtgtggc
cgtgccgaaatcatggatgcgcccgcgccgggcggcctcggcgggacctacgccggcaat
ccgctggcggtggcgtccgcgctggccgtgctcgacgtgctcgagtccgagaacctgatc
gcgcgaggcgcggagcttggcgaacgactgacggcccgcctgaacagcctcaagccgcgc
gtgccgcaaatcgccgaagtccgtggcatcggcgcaatggtggccgtggagttccgtcgc
gccgatggcagcccggatgcggagttcacccgcgaagtgcagaaccgcgcgctggagagg
ggcctgttgctgctgtcgtgcggcgtgtacggcaacgtgattcgcttcctgttcccgctg
accatccaggacgccgtgatgaacgagggcctcgacatcctggcagacgtgctgactcgc
tga

DBGET integrated database retrieval system