KEGG   Cupriavidus metallidurans: Rmet_1808Help
Entry
Rmet_1808         CDS       T00351                                 

Gene name
pepM
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00440  Phosphonate and phosphinate metabolism
rme01100  Metabolic pathways
rme01120  Microbial metabolism in diverse environments
rme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Rmet_1808 (pepM)
Enzymes [BR:rme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Rmet_1808 (pepM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 NTP_transferase IspD ICL Rsa3
Motif
Other DBs
NCBI-ProteinID: ABF08687
UniProt: Q1LMD9
LinkDB All DBs
Position
1959433..1961127
Genome map
AA seq 564 aa AA seqDB search
MNAHDPNLLATSRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQF
GVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKIFPKTNSFIGGEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALR
RAEAYRQAGADAILIHSKLSKADEIVTFAREWAGRAPLVIVPTKYYSTPTDVFRKAGISL
VIWANHLIRVAASSMQAVAREIHDSQTLVNVEDRIATVNEIFRLQDADEYSAAEKIYLTG
GQAPSSAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGINDITVVGGYK
AEAIDAAGIKLVRNERHAATGELASLACAADSLETDTVVSYGDLMFRSYILRDLLETDAP
FSVVVDSSESAPSNQSVRDFAWCSAADDRDLFGQKVLLRKISDTPAATDGEPHGRWIGLL
NVRGEGRARLQKLLAELRQRPDFDSLDMPDLINALVEAGEKVEVRYVHGHWRGVNDLEDF
RRAGDFAHTQTPYALGNNDGETAR
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccacgacccgaacctcctcgccacctcgcgcagcgcccgcctgcgccagatg
ctgcgctcgaacgaactcgaattcatcatggaagcccataacggcctgtccgcgcgcatc
gtgcgcgaggccggcttcaagggcatctgggcctcgggcctggccatctccgcccagttc
ggcgtgcgcgacaacaacgaggcaagctggacccaggtggtcgacaacctcgaattcatg
gccgatgccagcgatctgccgatcctgctggacggcgacaccggctacggcaacttcaac
aacgtgcgccgcctggtgcgcaagctcgagcagcgcggcatcgccggcgtctgcatcgaa
gacaagatcttcccgaagaccaacagcttcatcggcggcgagcagcagccgctggccgat
atcgacgagttctgcggcaagatcaaggccggtaaggattcgcaggccgacgacgacttc
tcgatcgtcgcgcgtgtcgaagcgctgatcgccggctggggcatggaagaagccctgcgc
cgcgccgaggcgtaccgtcaggccggcgccgacgccatcctgatccacagcaagctgtcg
aaggccgacgagatcgtgaccttcgcgcgcgaatgggccgggcgcgcgccgctggtgatc
gttcccaccaagtactacagcacgccgaccgacgtgttccgcaaggccggcatcagcctc
gtgatctgggccaaccacctgatccgcgtggccgcatcgtcgatgcaggctgtggcccgg
gaaatccacgacagccagacgctggtcaacgtggaagaccgcatcgccaccgtcaacgaa
attttccgcctgcaggatgccgacgaatactcggccgccgagaagatctacctgaccggt
ggccaggcgcccagctccgccgtggtgcttgcggccggacgcggcaagggcctggaggcc
ctgaccgaagacaagcccaagatcatgctgccggtagccggcaagccgctgctgcgctgg
ctggtcgacggcttcaagaaccagggcatcaacgacatcaccgtggtgggcggctacaag
gccgaggcgatcgacgcggccggcatcaagctggtgcgcaacgagcgccacgccgccacc
ggcgagctggcttcgctggcgtgcgccgccgattcgctcgagaccgacaccgtcgtctcc
tatggcgacctgatgttccgcagctacatcctgcgcgacctgctggaaaccgatgcgccg
ttcagcgtggtggtcgactcatccgagtccgccccgtcgaaccagagcgtgcgcgatttc
gcgtggtgctcggccgccgacgaccgcgacctgttcggccagaaggtgctgctgcgcaag
atctccgacacgccggccgctaccgacggagagccgcatggccgctggatcggtctgctc
aacgtgcggggcgaaggccgcgcgcgcctgcagaagctgctggccgaactgcgtcagcgg
cccgacttcgactcgctcgacatgcccgacctgatcaacgcgctggtcgaagccggcgag
aaggtcgaggtccgttacgtacatggccactggcgcggcgtgaacgacctggaggacttc
cgccgggccggagacttcgcgcacacgcaaacgccgtacgcgctgggcaacaacgacgga
gagactgcccgatga

DBGET integrated database retrieval system