KEGG   Cupriavidus metallidurans: Rmet_2483Help
Entry
Rmet_2483         CDS       T00351                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, FeS subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00020  Citrate cycle (TCA cycle)
rme00190  Oxidative phosphorylation
rme00650  Butanoate metabolism
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01120  Microbial metabolism in diverse environments
rme01130  Biosynthesis of antibiotics
rme01200  Carbon metabolism
Module
rme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rme_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rmet_2483 (sdhB)
   00650 Butanoate metabolism
    Rmet_2483 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Rmet_2483 (sdhB)
Enzymes [BR:rme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Rmet_2483 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     Rmet_2483 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4 Fer4_4 Fer2 Fer4_6 Fer4_16
Motif
Other DBs
NCBI-ProteinID: ABF09360
UniProt: Q1LKG6
LinkDB All DBs
Position
complement(2696816..2697517)
Genome map
AA seq 233 aa AA seqDB search
MKRIFEVYRYDPDKDAAPRMQTYEVELDGHERMLLDALVKLKKLDETISFRRSCREGVCG
SDAMNINGKNGLACLTNMRELPDRIVLRPLPGLPVVRDLIVDMTNFFKQYNSIKPFLIND
EPPPEKERLQSPQERDELDGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIADS
RDQATSERLDNLNDPYRLFRCHSIMNCVDVCPKGLNPTKAIGKIKELMVRRAV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtattttcgaagtctaccgctacgatccggacaaggacgccgcgccccgcatg
cagacctacgaggtggaactcgacggtcacgagcgcatgctgctggatgcgctggtcaag
ctgaagaagctcgatgagacgatctcgttccgtcgctcgtgccgtgaaggcgtgtgcggc
tcggacgcgatgaacatcaacggcaagaacggcctggcctgcctgacgaacatgcgcgaa
ctgccggaccgcatcgtgctgcgtccgctgcccggcctgcccgtggtgcgcgacctgatc
gtcgacatgacgaacttcttcaagcagtacaactcgatcaagccgttcctgatcaacgac
gagccgccgcccgagaaggagcgtctgcaatcgccgcaggaacgtgacgagctggacggc
ctgtacgagtgcatcttgtgcgcaagctgctcgacgtcgtgcccgtcgttctggtggaac
ccggacaagttcgttggcccggccggtctgctgcaggcctaccgctttatcgcggacagc
cgtgaccaggccaccagcgagcgtctggacaacctgaacgacccgtaccgtctgttccgt
tgccatagcatcatgaactgcgtcgatgtgtgcccgaagggcctcaacccgacgaaggcg
attggcaagatcaaggaattgatggttcgccgcgctgtttaa

DBGET integrated database retrieval system