KEGG   Cupriavidus metallidurans: Rmet_2484Help
Entry
Rmet_2484         CDS       T00351                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00020  Citrate cycle (TCA cycle)
rme00190  Oxidative phosphorylation
rme00650  Butanoate metabolism
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01120  Microbial metabolism in diverse environments
rme01130  Biosynthesis of antibiotics
rme01200  Carbon metabolism
Module
rme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rme_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rmet_2484 (sdhA)
   00650 Butanoate metabolism
    Rmet_2484 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Rmet_2484 (sdhA)
Enzymes [BR:rme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Rmet_2484 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     Rmet_2484 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO FAD_binding_3 HI0933_like GIDA Thi4 Lycopene_cycl NAD_binding_7 Pyr_redox_3 DUF2285
Motif
Other DBs
NCBI-ProteinID: ABF09361
UniProt: Q1LKG5
LinkDB All DBs
Position
complement(2697552..2699330)
Genome map
AA seq 592 aa AA seqDB search
MVAVKTGLPRRKFDVVIVGAGGAGMRASLQLAEAGLNVAVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPKVVYELEHFGMPFDRNADGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQRNVRAKTHFFVEWMALDLIRDEDG
DVLGVTALEMETGEVYILEAKTTLFATGGAGRIYAASTNAFINTGDGLGMAARAGVPLED
MEFWQFHPTGVAGAGVLITEGVRGEGGILRNKDGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGCGPNGDYVLLDLTHVGAETIMKRLPSIREIGMKFANVDAIKEPIPVVPTIHYQ
MGGIPTNFHGQVVVPKNGNPNEVVNGFYAIGECSCVSVHGANRLGTNSLLDLVVFGRAAG
NHIVANAMKQKEHKPLPADAADRAMARLAKLQGTTSGEYTQDVANDIRRNMQSHAGVFRT
QKLMDEGVERILEVAERANNIHLKDKSKVFNTALVEALEVSNLVEVAKATMISAAARKES
RGAHAHSDFPNRDDENWLKHTLFYSEGNRLDYKPVKMQPLTVESVPPKARTF
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcagtcaagactggattgccgcgtcgcaaatttgacgtggtcatcgtcggggcg
ggcggcgccgggatgcgcgcatccctccagctcgcggaagccggcctgaacgtggccgtg
ctgtcgaaggttttcccgacgcgctcgcacaccgtggcggcgcagggcggtatcggtgct
tcgcttggcaacatgagcgaagacaactggcactatcacttctacgacaccatcaagggc
tcggactggctgggcgaccaggacgccatcgagttcatgtgtcgtgaagcaccgaaggtc
gtgtacgaactcgaacacttcggcatgccgttcgaccgtaacgccgatggcacgatttac
cagcgtccgttcggcggccacaccgccaactacggcgaaaagccggtgcaacgcgcttgc
gcggccgctgaccgtaccggtcacgcgctgctgcacacgctgtaccagcgcaacgttcgc
gccaagacccacttcttcgtcgaatggatggcgctggatctgatccgcgacgaggacggc
gacgtgctgggcgtgaccgcgctggaaatggaaaccggcgaagtctatatcctcgaagcc
aagaccacgctgttcgcgaccggcggtgccggccgtatctacgcggcttccaccaatgcc
ttcatcaacaccggtgatggcctgggcatggcggcacgtgccggcgtcccgctggaagac
atggagttctggcagttccacccgaccggcgtggccggcgcgggcgtgctgatcacggaa
ggcgtgcgcggcgagggcggtatcctgcgtaacaaggatggcgagcgcttcatggagcgc
tatgccccgacgctgaaggatctggctccgcgtgacttcgtgtcgcgttcgatggaccag
gaaatcaaggaaggccgcggctgcggtccgaatggcgactacgtgttgctcgacctgacg
cacgtcggcgccgagacgatcatgaagcgtctgccgtcgatccgcgaaatcggcatgaag
ttcgccaacgtcgacgcgatcaaggaaccgatccccgtggtgccgaccatccactaccag
atgggtggcattccgacgaacttccacggtcaggtcgtggtgccgaagaacggcaacccg
aacgaagtggtcaacggcttctacgccatcggcgaatgctcgtgcgtgtcggtgcacggc
gccaaccgtctgggcacgaactcgctgctcgacctcgtggtgttcggccgtgcggccggt
aaccacatcgtcgccaacgcgatgaagcagaaggaacacaagccgctgccggcagatgcc
gccgaccgcgccatggcccgtctggccaagctgcagggcacgacctcgggtgaatacacc
caggacgtggccaacgatatccgccgcaacatgcaatcgcacgccggcgtgttccgtacg
cagaagctgatggacgaaggcgtcgagcgcatcctggaagtggccgagcgcgccaacaac
atccacctgaaggacaagtcgaaggtctttaacaccgcgctggtggaagccctggaagtg
tcgaacctggtggaagtggccaaggcaacgatgatctcggccgcagcccgcaaggaatcg
cgtggcgcccacgcccatagcgacttcccgaatcgcgacgacgagaactggctcaagcac
acgctgttctacagcgaaggcaaccgcctcgactacaagccggtgaagatgcaaccgctg
acggtggaatcagttccgccgaaggcccgtacgttctga

DBGET integrated database retrieval system