KEGG   Cupriavidus metallidurans: Rmet_2757Help
Entry
Rmet_2757         CDS       T00351                                 

Gene name
sodC
Definition
(GenBank) Superoxide dismutase (Cu-Zn) 2 precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rme  Cupriavidus metallidurans
Brite
Enzymes [BR:rme01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Rmet_2757 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABF09630
UniProt: Q1LJP6
LinkDB All DBs
Position
complement(2998267..2998842)
Genome map
AA seq 191 aa AA seqDB search
MKRVLFGLTMGAAALAVAGCSSWGWGSSSSSSSSGTAATSASTKAAAALSPKSGTNTAGR
VTFDQQAGGGVMVVVSVTGLPPGTTHGFHIHEKGDCSAPDAMSAGGHFNPAGKPHGQMTM
PDHHAGDMNNLVADSSGNARVQFIMPDVTVAPGPNSVVGRAVVVHKDADDYRTQPTGNSG
GRIACGVIAAS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgtacttttcggtttgacgatgggcgctgccgcactggctgtggcgggttgc
tcgagctggggctggggttcgtccagcagcagtagcagcagtggcacggcggcaaccagc
gcgtccacgaaggccgccgcagcgctgagccccaagagcggcacgaataccgcgggacgc
gtcacgttcgaccagcaggcgggcggtggcgtgatggtggtggtatcggtgaccggcctg
ccgccaggcacgacacatggcttccatatccacgagaagggtgactgctccgcgcccgac
gcgatgagcgcgggtgggcacttcaacccggcaggcaagccgcatggccagatgacgatg
cccgatcatcatgccggcgacatgaacaacctcgtcgcggactccagcggcaacgcgcgc
gtgcagttcatcatgccggacgtgaccgtggcacccggcccgaacagcgtggttggccgc
gccgtcgttgtccacaaggatgccgacgactatcgcacccagcccaccggcaactcgggc
ggccgcatcgcctgcggtgtgatcgccgcctcctga

DBGET integrated database retrieval system