KEGG   Cupriavidus metallidurans: Rmet_3175Help
Entry
Rmet_3175         CDS       T00351                                 

Gene name
apaG
Definition
(GenBank) protein associated with Co2+ and Mg2+ efflux
  KO
K06195  ApaG protein
Organism
rme  Cupriavidus metallidurans
Brite
KEGG Orthology (KO) [BR:rme00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Rmet_3175 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ABF10047
UniProt: Q1LIH9
LinkDB All DBs
Position
complement(3448106..3448480)
Genome map
AA seq 124 aa AA seqDB search
MSEYAFSVAVRTQYMPDQSDPDRGRYAFAYTITIHNTGEVAAQLISRHWIITDSDNSTQE
VSGLGVVGHQPLLKPGEHFEYSSWATISTPVGSMKGDYFCVAEDGHRFEVPIPEFALVLP
RMLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtacgcattttccgtggccgtgcgcacgcagtacatgccggaccaatcggac
ccagaccgtggacgctacgcgttcgcctacaccatcacgatccacaacaccggcgaagtc
gccgcgcagctgatctcgcgccactggatcatcaccgacagcgacaactcgacgcaggaa
gtctcgggcctgggcgtggtcggccatcagccgctgctcaagccgggcgagcacttcgag
tattcgagctgggcgacgatctccaccccggtgggatcgatgaagggcgattatttctgc
gtggccgaagacggccaccgtttcgaggtgccgattcccgaattcgcgctggtgctgccc
cgaatgctgcactga

DBGET integrated database retrieval system