KEGG   Cupriavidus metallidurans: Rmet_3669Help
Entry
Rmet_3669         CDS       T00351                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00071  Fatty acid degradation
rme00280  Valine, leucine and isoleucine degradation
rme00281  Geraniol degradation
rme00362  Benzoate degradation
rme00592  alpha-Linolenic acid metabolism
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01120  Microbial metabolism in diverse environments
rme01130  Biosynthesis of antibiotics
rme01212  Fatty acid metabolism
Module
rme_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rmet_3669
   00592 alpha-Linolenic acid metabolism
    Rmet_3669
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rmet_3669
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Rmet_3669
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rmet_3669
   00642 Ethylbenzene degradation
    Rmet_3669
Enzymes [BR:rme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     Rmet_3669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Defensin_propep
Motif
Other DBs
NCBI-ProteinID: ABF10541
UniProt: Q1LH35
LinkDB All DBs
Position
megaplasmid:206336..207538
Genome map
AA seq 400 aa AA seqDB search
MSEAFIVDAIRTPIGRYAGSLSGVRADDLGAVPLKALMARNASVDWSAIDDVIFGNANQA
GEDNRNVARMSALLAGLPDAVPGATINRLCGSGMDATGTAARAIKAGEANLMISGGVESM
SRAPFVMGKATSAFSRDAQIFDTTIGWRFINPAMRAAYGVDSMPETAENVATDYKIGRED
QDLMALRSQEKASRAQADGTLAQEITPVTIPQKKGDAIVVDRDEHPRATSMEALAKLRGV
VRPDGTVTAGNASGVNDGACALLLASEAGLKQHGLKPRARIVGMATAGVAPRVMGIGPAP
ATQKLMKQLGMTLDQIDVIELNEAFAAQGLAVLRQLGIADDDKRVNPNGGAIALGHPLGM
SGARLVTTAMYQLERTGGRFALCTMCIGVGQGIAMVIERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcattcatcgttgacgccatccgtacccccatcggccgttacgccggcagc
ctgtccggcgtgcgcgcggacgacctgggcgccgtgcccctgaaggccctgatggcccgt
aacgccagcgtggactggtcggcgatcgacgacgtgatctttggcaacgccaaccaggcc
ggtgaagacaaccgcaacgttgcgcgcatgtcggccctgctggctggcctgccggacgcc
gttcccggcgcgacgatcaaccgcctgtgcggttcgggcatggacgccaccggcaccgcc
gcccgcgccatcaaggctggtgaagccaacctgatgatttccggcggcgtggaaagcatg
agccgcgccccgttcgtcatgggcaaggccacctcggccttctcgcgtgacgcgcagatc
ttcgacacgaccatcggctggcgtttcatcaacccggcgatgcgcgccgcctacggcgtg
gactcgatgcccgagaccgccgagaacgtggcgaccgactacaagatcggccgtgaagac
caggatctgatggcgctgcgcagccaggagaaggcatcgcgcgcgcaagccgacggcacg
ctggcgcaggaaatcaccccggtgacgattccgcagaagaagggcgacgccatcgtggtc
gaccgcgacgaacatccgcgtgccacgagcatggaagcgctggccaagctgcgcggcgtg
gtgcgtccggacggcacggtgaccgccggtaacgcctcgggcgtgaacgatggcgcgtgc
gcgctgctgctggccagcgaagcgggcctgaagcagcacggcctgaagccgcgtgcccgc
atcgttggcatggcaacggctggtgtggcaccgcgcgtgatgggtatcggcccggcgccg
gccacgcagaagctgatgaagcaactgggcatgacgctggaccagatcgacgtgatcgaa
ctgaacgaagcgttcgccgcgcaaggcctggccgtactgcgtcaactgggcatcgccgac
gacgacaagcgtgtgaacccgaacggcggcgccatcgcactgggccacccgctcggcatg
agcggcgcgcgtctggtgacgaccgcgatgtaccagctggagcgcactggtggccgcttc
gcgctgtgcacgatgtgcatcggcgtgggccagggcatcgccatggtgatcgagcgcgtt
tga

DBGET integrated database retrieval system