KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1125Help
Entry
Rhom172_1125      CDS       T01606                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg00620  Pyruvate metabolism
rmg00680  Methane metabolism
rmg01100  Metabolic pathways
rmg01120  Microbial metabolism in diverse environments
rmg01200  Carbon metabolism
Module
rmg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rhom172_1125
  09102 Energy metabolism
   00680 Methane metabolism
    Rhom172_1125
Enzymes [BR:rmg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Rhom172_1125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AEN73054
UniProt: G2SIX9
LinkDB All DBs
Position
complement(1298311..1301127)
Genome map
AA seq 938 aa AA seqDB search
MSVLPPLQIEIEGTGISRPLSEHVNLLGGLLGQVIQEMAGPEMLELVETLRRLCKQAALD
SRPELREQAYMRIHSATYDELLWLLRAYTAFFHLVNQAEQQEIIRINRERAQQSTPEHPR
PESIDEAILALKQQGRTLDEVLALLERLDIQPTLTAHPTEARRRSILYKQQHIARLLSQQ
RRCRLTPEEQEALLVDLHNQITLLLGTAEVREERPTVRDEVEQGLYFIQSTIWEAVPRIH
EDVRRALRRYYGTDADFRPFLRYRSWIGSDRDGNPYVTPEITRWTALTQRRLVLQRYMEE
LRQLRRRLSLSDRYVPPPEELRRSLARDAREVLLPPHVLRQFRHESFRLKISYIMGRLHG
LLQALDDPSQPAPDYDADAFVEDLRLLQRCLEACGLERIARHDQLTRLLVLAQTFGFHLV
TLDVRQHSSVHEAAVAELLRLAGVENDYRALPESRRQELLADELSNPRPLLPPGARVSEA
TRQVLETFAVIRELVQLDPRLVGSYIVSMTHTVSDLLEPMLLAKEVGLWHYERDPRTGRP
GNVRCPIDFVPLFETIEDLEAAASRMEAILSHPVYRMQVAARGGFQEIMLGYSDSTKDGG
YWMANWALHRAQEQLAEVCRRHGVDFRLFHGRGGTVGRGGGRANQAILAMPPVVHNGRIR
FTEQGEVISFRYALPEIAHRHLEQIVNAMLRVVGLPAASGTDGTDPATRNRLMDELAARS
MRAYRRLIDTSDFWSWYTRITPIEQISRLPIASRPVSRSSAREVDFESLRAIPWVFAWTQ
VRYLIPGWFGIGQALDELLQASPEHLETLRTWYQSWPFFRTVLQNAQREMVRARLEIAAY
YDRLLGDGPTAFHQMIEEDFQRARTAILRITDQEELLDHDPIIRKSVQLRNPYTDVLNLV
QLELMRRYRQAPEADREPLRRALFLSINGIAAAMQSTG
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcttcctcctttgcagatcgaaatcgaaggcaccggcatttcccggccgctc
agcgagcacgtgaacctgctcggcggcctgctgggacaggtcattcaggaaatggccggt
cccgaaatgctggagctggtcgagacgctgcgacgcctgtgcaagcaggcggccctggac
agccgcccggaactccgggagcaggcctacatgcgtatccacagcgccacctacgacgaa
ctgctgtggctgctgcgcgcctatacggcctttttccacctggtcaaccaggccgagcag
caggaaatcatccggatcaaccgggaacgagcgcagcagagcacgcccgaacatccgcgt
ccggagtcgatcgatgaggccatcctggcgctcaagcagcagggccggacgctcgacgaa
gtgctggcgttgctggagcggctggacattcagcccacgctgaccgcccatcccaccgaa
gcacgccgccgcagcatcctctacaagcagcagcacatcgcccggctgctttcgcagcaa
cgccgctgccggctcacgcccgaggagcaggaagccctgctggtggacctgcacaaccag
atcacgctgctgctgggcacggccgaggtgcgcgaggaacgccccaccgtccgggacgaa
gtcgaacagggtctgtacttcattcagagcacgatctgggaggcagtgccccgcattcat
gaagacgtgcgccgggcgctgcgccgctactacggcaccgacgccgacttccggccgttt
ctgcgctaccgctcctggatcgggagcgaccgcgacggcaacccttacgtcacgccggaa
atcacgcgctggacggccctgacgcagcgacggctggtgctccagcgctacatggaggag
ctgcgccagctccgacgccggctgagtctttcggatcgctacgtgccgcccccggaggag
ctacgccgctcgctggcccgcgacgcccgggaagtattgctcccgccccatgtgcttcgc
cagttccggcacgagtcgttccgactgaagatctcctacatcatggggcggctgcacggg
ctgctccaggcgctggacgatccgtcgcaacctgcgcccgactacgacgccgacgccttc
gtcgaagacctgcggctgttgcagcgctgcctggaagcctgcggtctggagcgcatcgcg
cggcacgatcagctcacgcgtctgctggtgctggcccagacgttcggctttcatctggtc
acgctcgacgtgcgccagcacagcagcgtgcacgaagccgccgtggccgagctgctcagg
ctggccggggtcgagaacgactaccgggccctgcccgagtcgcgccgccaggagctgctg
gccgacgaactgagcaatccgcggccgctgctgccgccgggggcccgggtgtcggaagcc
acgcggcaggtgctggagaccttcgcggtcatccgcgagctggtgcagctcgaccctcgc
ctcgtgggcagctacatcgtgagcatgacgcacaccgtcagcgatctgctcgagcccatg
ctgctggccaaagaagtcgggctctggcactacgaacgcgacccgcgcaccggcaggccg
ggcaacgtgcgctgccccatcgatttcgtgccgcttttcgagacgatcgaagacctggag
gcggcggccagccgcatggaagccatcctgagccaccccgtctaccggatgcaggtggct
gcccgcggcggctttcaggagatcatgctgggctactccgacagcacgaaagacgggggc
tactggatggccaactgggcgctgcatcgggcgcaggagcaactggccgaagtgtgccgc
cgccacggcgtggacttccggctgtttcacgggcgcggcggtactgtgggacgtgggggc
ggccgcgccaaccaggccatcctggccatgccgccggtggtccataacggccgcattcgc
ttcaccgagcagggcgaggtgatctcgttccgctatgccctgcccgagatcgcccatcgc
cacctggagcagatcgtcaatgccatgctccgcgtggtcggcctcccggccgcttccggc
accgatggcaccgatccggccacgcgcaaccgcctgatggacgagctggccgcgcgctcc
atgcgggcctaccggcgcctgatcgacacgtctgacttctggtcgtggtacacgcgcatc
accccgatcgagcagatcagccgcctgcccatcgcctcgcggccggtctcgcgcagcagc
gcccgcgaagtcgacttcgaaagcctgcgggccatcccctgggtcttcgcctggacccag
gtccgctacctgattccgggctggttcgggatcggccaggccctcgacgaactactccag
gcctcgcccgagcacctggagacgctccgcacctggtatcagtcctggccgttcttccgc
actgtgctgcagaacgcccagcgcgagatggtccgcgcccgcctggaaattgccgcctac
tacgaccggctgctgggcgacggcccgacggcattccaccagatgatcgaagaagatttt
cagcgggcccgtacggccatcctgcgcatcaccgatcaggaagagctgctcgatcacgat
ccgatcatccgcaaatccgtgcagctccgcaatccgtacaccgatgtgctgaacctggtg
cagctcgaactgatgcgacgctatcgccaggcccccgaggccgatcgggagccgctccgg
cgcgccctgttcctgagcatcaacggcatcgccgccgccatgcagagcaccggatag

DBGET integrated database retrieval system