KEGG   Roseovarius mucosus: ROSMUCSMR3_00831Help
Entry
ROSMUCSMR3_00831  CDS       T04779                                 

Gene name
hisE
Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
rmm  Roseovarius mucosus
Pathway
rmm00340  Histidine metabolism
rmm01100  Metabolic pathways
rmm01110  Biosynthesis of secondary metabolites
rmm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rmm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ROSMUCSMR3_00831 (hisE)
Enzymes [BR:rmm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     ROSMUCSMR3_00831 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG Importin_rep_3 PSK_trans_fac
Motif
Other DBs
NCBI-ProteinID: ARE82330
UniProt: A0A1V0RKN5
LinkDB All DBs
Position
complement(853820..854134)
Genome map
AA seq 104 aa AA seqDB search
MTLDDLARIIAARAAADPESSWTAKLLAKGPEKCAEKFGEEAIEAIIEAVKGDRARLTSE
AADVLFHLLVMLQSRDVALSDVMAELARRQGTSGLAEKASRSKD
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgacgatcttgcccgtatcatcgccgcgcgcgctgccgccgatcccgaaagt
agttggaccgccaaactcttggccaaaggcccggaaaaatgcgccgagaaattcggcgaa
gaggccattgaggcgatcattgaagcggtcaaaggcgaccgcgcgcgcctgacctctgaa
gcggcggatgtgctctttcacttgctggtgatgctgcaatcgcgcgacgtcgccctatct
gatgtcatggctgaacttgcccgtcgtcagggcacctctggccttgcagaaaaagcctcc
cgctcgaaagactga

DBGET integrated database retrieval system