KEGG   Ralstonia mannitolilytica: TK49_07960
Entry
TK49_07960        CDS       T03778                                 

Definition
(GenBank) 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase
  KO
K14582  cis-1,2-dihydro-1,2-dihydroxynaphthalene/dibenzothiophene dihydrodiol dehydrogenase [EC:1.3.1.29 1.3.1.60]
Organism
rmn  Ralstonia mannitolilytica
Pathway
rmn00624  Polycyclic aromatic hydrocarbon degradation
rmn00626  Naphthalene degradation
rmn01100  Metabolic pathways
rmn01120  Microbial metabolism in diverse environments
rmn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rmn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    TK49_07960
   00624 Polycyclic aromatic hydrocarbon degradation
    TK49_07960
Enzymes [BR:rmn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.29  cis-1,2-dihydro-1,2-dihydroxynaphthalene dehydrogenase
     TK49_07960
    1.3.1.60  dibenzothiophene dihydrodiol dehydrogenase
     TK49_07960
SSDB
Motif
Pfam: adh_short_C2 adh_short NmrA NAD_binding_10 Epimerase KR
Other DBs
NCBI-ProteinID: AJW46266
LinkDB
Position
1:1667502..1668281
AA seq 259 aa
MSTQQVIAITGAGSGIGLELVRSFKAAGYCVSALVRNEEQEAGLRSEFKDAIEIVAGDVR
DHATNEKLVKQTVAKFGRLDCFIGNAGIWDYMLSIDEPWEKFSGSFDEIFDINVKSYFSG
ISAALPELKKTNGSVVVTASVSSYAVGGGGSCYIASKHAVLGMVKALAYELAPHIRVNGV
APGGTVTSLAGPASAGFDKTKMKDMPGIDDMIKGLTPLGFAARPEDVVAPYLLLASREQG
KFITGTVISIDGGMALGRK
NT seq 780 nt   +upstreamnt  +downstreamnt
atgagcacacagcaagttattgccatcactggagccggctcgggcatcgggctggaactg
gttcgatccttcaaagcagctggctattgcgtgtccgcacttgttcgcaatgaggaacaa
gaggcgggtcttcgcagtgaattcaaagatgccattgagatcgtggcgggcgatgtccgt
gatcacgccaccaatgagaagctggttaaacagacggttgccaagttcgggcgcctggat
tgcttcatcggaaatgccgggatatgggattacatgctgagcatcgatgagccttgggag
aaattctcgggcagtttcgacgagatatttgacatcaacgtcaaaagctatttcagcggc
atcagcgcggccttgccggagctcaaaaagacgaacggatcggtggtggtgacggcttcc
gtttcttcctatgcggtcggcggcggcggctcttgctacattgccagcaagcatgcagtg
ctgggcatggtcaaggcgttggcctacgaattggctccgcacatccgggtcaatggcgtt
gcgccaggtggcacggtcacttctttggctggcccggcaagcgctggcttcgacaaaacc
aaaatgaaagacatgcccggcatcgatgacatgatcaaaggcctgactcccctggggttc
gcggcaaggcccgaggacgtggtggcaccgtaccttttgctggcctcccgggaacaaggg
aagttcatcactggcacggtgatcagcattgatggcggcatggctctcggccgcaagtga

DBGET integrated database retrieval system