KEGG   Ralstonia mannitolilytica: TK49_07965
Entry
TK49_07965        CDS       T03778                                 

Definition
(GenBank) dehydrogenase
  KO
K00152  salicylaldehyde dehydrogenase [EC:1.2.1.65]
Organism
rmn  Ralstonia mannitolilytica
Pathway
rmn00626  Naphthalene degradation
rmn01100  Metabolic pathways
rmn01120  Microbial metabolism in diverse environments
rmn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rmn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    TK49_07965
Enzymes [BR:rmn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.65  salicylaldehyde dehydrogenase
     TK49_07965
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AJW44648
LinkDB
Position
1:1668330..1669781
AA seq 483 aa
MKTKLFINNTWRASSDKKSFDRKHPVSGEVVTQCANATVDDAVDAARAAQEAFKSWKAVG
PSERRRLLLKVADVMESKTPEFIEVMAKEVGASALWAGFNVHLSANVFREAASLATQIQG
ETIPTDKPDTLSMTLRQPVGPILSIVPWNGTAVLAARAIAYPLVCGNTVVFKGSEFSPGT
HALITKCLQEAGLPAGVLNYLNSSPDRSPDIADALISSKEIRRINFTGSTRVGRIIAQKA
AQHLKRCLLELGGKSPLIVLDDADIDAAVKAAVFGSFLFQGQICMSTERLVVDEKIADEF
VAKFAAKTKQLSAGDPCVTGDCIIGPMVSPNSGDRINALFKDAIDKGAKVVCGGMAEGAV
MPATILDHVTADMQIYDEETFGPITVVIRCKGEADAIRIANDSAYGLSSGVFGRDVNRAL
RVGMAIEYGSVHINGSTVQNEAQAPYGGTKATGYGRFDGRAVIDEFTELKWLTIEPFEQQ
YPF
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaagacgaaattgttcatcaacaacacctggcgcgcttcgagtgacaaaaagtcattc
gatcgcaagcaccctgtcagtggcgaggtcgtgacccaatgcgcgaacgccacggtggac
gatgcggtcgatgcggctcgagccgctcaagaggcgttcaagtcctggaaggccgttggg
ccttcggagcggcggcgccttcttttgaaggtggcagacgtcatggagagcaaaacgccc
gagttcatcgaagtgatggccaaggaagtgggagcctccgcgctgtgggcggggttcaac
gtgcacctgtcggccaatgtattccgggaagccgcctcactggccacccaaattcaaggc
gaaaccattccgacggacaagcctgacaccctgtcaatgacgctgcgtcagcctgtcggc
cccatcttgagcatcgttccctggaacggcaccgccgtgctcgcggcgcgggccatcgct
tatccgctggtctgcggcaataccgttgtgttcaaaggctccgagttcagccccggcacg
cacgctttgatcaccaagtgcctgcaggaggccggcctgcctgctggcgtgctcaattat
ctgaactcgtccccggaccgctcgcccgatatcgccgatgcgctgatttcgtctaaagag
attcgtcgcatcaacttcacgggctccactcgcgtggggcgcatcatcgcccagaaagcg
gcccaacatctcaagcgttgcttgctggagttgggcggcaagtccccgctgatcgttctg
gacgacgctgacatcgacgcggcggtcaaggcagcggtgttcggcagcttcctgttccaa
ggccagatctgcatgtccaccgaacgcctggtggtcgacgagaagatcgcggacgaattt
gtcgcgaaattcgccgcgaaaaccaagcagttgagcgcaggcgatccatgcgtcaccggg
gactgcatcatcggcccgatggtgtcgcccaactcgggggaccggatcaatgctctgttc
aaagatgccatcgataagggcgccaaggtcgtgtgcggcggcatggccgagggtgcagtc
atgcccgccacgatcctggaccacgtgacagccgacatgcagatctacgatgaggaaacc
ttcggtcccatcactgtggttatccggtgcaagggcgaagccgatgccatccgtattgcc
aacgacagtgcatatggcctgtcatcgggcgtgtttggccgggacgtgaaccgggctctg
cgcgtgggcatggcgatcgaatacggctcggtccatatcaacggctccaccgtacagaac
gaggcgcaggcgccttatggcggcacaaaggccaccggttatggccgcttcgacggacgc
gcggtgatcgacgagttcacggaactcaagtggctgaccattgaaccattcgagcagcag
tatcccttctaa

DBGET integrated database retrieval system