KEGG   Ralstonia mannitolilytica: TK49_07970
Entry
TK49_07970        CDS       T03778                                 

Definition
(GenBank) naphthalene 1,2-dioxygenase
  KO
K14583  1,2-dihydroxynaphthalene dioxygenase [EC:1.13.11.56]
Organism
rmn  Ralstonia mannitolilytica
Pathway
rmn00626  Naphthalene degradation
rmn01100  Metabolic pathways
rmn01120  Microbial metabolism in diverse environments
rmn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rmn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    TK49_07970
Enzymes [BR:rmn01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.56  1,2-dihydroxynaphthalene dioxygenase
     TK49_07970
SSDB
Motif
Pfam: Glyoxalase MutS_I
Other DBs
NCBI-ProteinID: AJW44649
LinkDB
Position
1:1669807..1670724
AA seq 305 aa
MNKPATVIELGYMGISVKDPAAWKSFAANMLGLQVLDEGDKDRFYLRMDNWHHRIVVHHN
GQDDLDDLEYLGWRVAGQPEFEALGQKLVDAGYKVRVCDKAEAQERMVLGLMKTEDPGGN
PTEIFWGPRIDLNNPFHPGRPLHGKFLTGDQGLGHCIVRQNDVEAARKFYSLLGFRGDVE
YRLPLPNGMTAELTFMHCNARDHSIAFGSMPAAKRLNHLMIEYTHIEDLGYTYQLFKKEK
IDIALQLGIHSNDKALTFYGATPSGWLIEPGWRGAPAIDESEYYVGDIFGHAIEATGYGL
DVKLS
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaacaagccagcaactgtcattgaattggggtacatgggcatttcggtcaaggatccc
gcagcgtggaaatcctttgccgcaaacatgctgggacttcaagtcctcgatgagggtgac
aaggatcgcttctatctgcgaatggacaattggcaccaccggatcgtggttcatcacaac
ggtcaagatgaccttgatgaccttgaatacttaggctggcgtgtcgccggtcaaccggaa
ttcgaggcattgggtcaaaagctcgtggacgcaggctacaaagtccgcgtgtgcgacaaa
gccgaagcacaagaacggatggtactgggcctgatgaagacagaagatccggggggcaac
ccgaccgagattttctggggacctcggattgacctgaacaatcccttccaccccggtcgt
cccttgcacggaaaatttctaaccggcgatcagggcctaggccactgcatcgtgcgtcag
aatgatgttgaagcggcgcgtaagttctatagcttgctgggatttcgtggagatgtcgag
taccgccttcctttgcccaacggcatgacggctgagttgacgttcatgcattgcaatgct
cgcgatcattccatcgctttcggttcaatgcctgcggccaagcgcctcaatcatctgatg
attgaatacactcatatcgaagatttgggttacacataccagcttttcaagaaggaaaag
attgacattgccttgcaattgggcatccattccaacgataaggcgctgacgttctacggg
gcaacaccttccggctggctgatcgaacctgggtggcgaggcgcccccgccattgatgaa
tcggaatattacgtcggcgacattttcggtcacgccatcgaggccaccggttatggattg
gacgtcaaactgagctag

DBGET integrated database retrieval system