KEGG   Ralstonia mannitolilytica: TK49_20080Help
Entry
TK49_20080        CDS       T03778                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rmn  Ralstonia mannitolilytica
Brite
KEGG Orthology (KO) [BR:rmn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TK49_20080
Enzymes [BR:rmn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     TK49_20080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored Glutaredoxin DAO FAD_binding_2 FAD_binding_3 Thi4 AlaDh_PNT_C baeRF_family10 FMO-like K_oxygenase NAD_binding_8 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AJW46993
LinkDB All DBs
Position
2:767404..768978
Genome map
AA seq 524 aa AA seqDB search
MLDADVKAQLKAYLERLVQPIELVANVDDSEGSRDMMELLRDVAEQSGMISLTEQRDAAE
RAPSFLIRRTGADVSVRFAAVPTGHEFTSLVLALLQVGGYAPKLDADVIEQIRNIEGDFR
FETYMSLTCQNCPDVVQALNVMSVINPRIQHVAIDGALYQGEIEARQIMAVPTVFLNGEM
FGTGRMGVEEILAKIDTGAVARDAEKLAAKEAFDVLIVGGGPAGAAAAVYAARKGVRTGV
VAERFGGQVLDTLGIENFISVQETEGPKFAAALEQHVRQYEVDIMNAQRAVKLTPADKPG
GFAKVTLANGAVLKGRSVILSTGARWRNVNVPGEQEYKNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGLVSHVTLLEFAGELKADAVLVRKLQSLPNATIVTNAQTTEITGD
GQKVNGLRYKSRVDGAEHEIALEGVFVQIGLVPNTEWLDGAVERNRFGEIVVDARGQTSA
EGVFAAGDATTTPYKQIIIATGDGAKAALSAFDHLIRVPLAEAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgctgatgtcaaggcccaactgaaggcctacctcgaacgcctcgtgcagccc
attgagctggtcgccaacgtcgatgacagcgagggctcccgcgacatgatggagctgctg
cgcgacgtggccgagcagtccggcatgatctcgctcaccgaacaacgcgatgccgccgag
cgcgcgccgtcgttcctgatccgccgcaccggcgccgacgtgagcgtgcgctttgcggcc
gtgccgactggccacgagttcacctcgctcgtgctggcgctgctgcaggtgggaggctat
gcgcccaagctcgatgccgacgtcatcgagcagatccgcaacatcgaaggcgatttccgc
ttcgagacgtacatgtcgctcacgtgccagaactgcccggacgtggtccaggcgctgaac
gtgatgtcggtcatcaacccgcgcatccagcacgtcgccatcgacggcgcgctgtatcag
ggcgagatcgaggcgcgccagatcatggccgtgccgaccgtgttcctgaacggcgagatg
ttcggcacgggccgcatgggcgtggaagagatcctggccaagatcgacaccggcgccgtc
gcgcgtgacgctgagaagctggctgccaaggaagcgtttgacgtgctgatcgtcggcggt
ggcccggcgggtgccgctgcggccgtgtatgcggcgcgcaagggcgtgcgcaccggtgtg
gtggccgagcgctttggcggccaggtgctcgacacgctgggcatcgagaacttcatctcc
gtgcaggagaccgaagggccgaagtttgccgccgcgctggagcagcacgtgcgtcagtac
gaggtcgacatcatgaacgcacaacgcgcggtcaagctgacccctgcggacaagccgggc
ggctttgccaaggtgacgctggccaacggcgcggtgctcaagggccgttcggtcatcctg
tcgaccggcgcgcgctggcgcaacgtcaacgtgccgggcgagcaggaatacaagaacaag
ggcgtggcgtactgcccgcactgcgatggcccgctgttcaagggcaagcgcgtggccgtc
atcggcggcggcaactccggcgtggaggcggccatcgacctggccggcctggtcagccac
gtcacgctgctcgagtttgccggcgagctgaaggcggacgccgtgctggtgcgcaagctg
caaagcctgccgaacgcgaccatcgtcaccaacgcgcagaccaccgagatcacgggtgac
ggccagaaggtcaacggcctgcgttacaagagccgcgtggacggcgccgagcatgagatc
gcgctcgaaggcgtgttcgtgcagatcggcctggtgcccaacaccgaatggctggatggc
gcggtggagcgcaaccgctttggcgagatcgtcgtcgatgcgcgcggccagaccagcgcg
gaaggcgtgtttgccgcaggcgatgcgaccacgacgccgtacaagcagatcatcatcgcc
accggcgatggtgcgaaggccgcgctgtcggcattcgaccacctcatccgcgtgccgctg
gccgaggcggcataa

DBGET integrated database retrieval system