KEGG   Rickettsia montanensis: MCI_05055Help
Entry
MCI_05055         CDS       T01784                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rmo  Rickettsia montanensis
Pathway
rmo00020  Citrate cycle (TCA cycle)
rmo00190  Oxidative phosphorylation
rmo00650  Butanoate metabolism
rmo01100  Metabolic pathways
rmo01110  Biosynthesis of secondary metabolites
rmo01120  Microbial metabolism in diverse environments
rmo01130  Biosynthesis of antibiotics
rmo01200  Carbon metabolism
Module
rmo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rmo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rmo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCI_05055 (sdhA)
   00650 Butanoate metabolism
    MCI_05055 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MCI_05055 (sdhA)
Enzymes [BR:rmo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MCI_05055 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     MCI_05055 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AFC73833
UniProt: H8KBW7
LinkDB All DBs
Position
891483..893273
Genome map
AA seq 596 aa AA seqDB search
MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKLFPTRSHTVAAQGGISAA
LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ
RPFGGMTTEYGKGKAAQRTCAAADRTGHAMLHTLYQQSLKHKVQFFVEYFAIDLLMEDGE
CRGVVAWNLDDGSLHCFRAHSVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQDM
EFVQFHPTGIYSVGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTIE
IREGRGVGEHKDHVFLHLNHLSPEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYNM
GGIPTNYHGQVIIKDGKNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSAL
KAAELIKPASPHKSIKEESLEKIINRFDKVRHANGNILVAELRLKMQRTMQSHASVFRTQ
EVLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKESR
GAHAREDYPDRNDGDWMKHTLSSIDEAGEVVLDYKPVTLTTLTDEVTAVPPAKRVY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagcgtataatatcattcatcataaatttgacgtagtagttgtaggtgcaggc
ggagcaggtcttcgttctgcattcggtatggctaaagaaggactaaatactgcttgtata
actaagctgttcccaacccgtagtcatactgtggctgctcagggcggaattagtgcggct
cttgggaatatgggcgaagatgattggcgttggcatatgtatgatacggtaaaaggttct
gattggttaggcgatcaggatgccattgagtatatgtgcaaaaacgctcccgatgcgatt
ttagagctagagcattacggtgtacctttctcaagaactgaagagggaaaaatttatcag
cgtccttttggaggaatgacaacagagtacggcaaaggaaaagcagctcagcgtacatgt
gctgcggcagatcgtacggggcatgccatgcttcatactttatatcaacagtcactaaaa
cataaagtacagtttttcgttgagtattttgctattgatttattgatggaagatggtgaa
tgtagaggagtagttgcgtggaatttagatgacggtagtctgcattgttttagagctcat
agtgtagtgcttgcaacgggcggatacgggcgtgcttatttttcggcgacgtctgctcat
acttgtacgggtgatgggggtggcatggcgattagagccggtcttccactgcaagatatg
gaatttgtacagttccatccgacaggtatatattcggtgggctgtcttattaccgagggg
gcaagaggcgaagggggatatctcgttaatgcaaatggtgagcgttttatggagcgttat
gctcctgctgcaaaggatttagcttcaagagatgtagtttcaagagcaatgactatagaa
atcagagaggggcgaggagtcggcgagcataaagatcatgtatttttacatttaaatcat
ttatcgcctgagattttacatagtcgtttgcccggtatctctgagacggctaaaattttt
gccggtgttgacgtgactaaagagccgataccggtacttcctacggtacattataatatg
ggcgggataccgacgaattatcacggtcaagtcataatcaaagacggtaaaaatcataat
agcgtagtaaaagggcttatggcaatcggtgaagcggcttgcgtatcggtacacggtgct
aaccgattaggatcaaattctttgcttgatttagtagtatttggtagaagttctgcatta
aaagcagccgagcttattaagcctgcgagtccccacaagtctataaaagaagaaagcctt
gaaaaaattataaatagatttgataaagtccgtcacgctaacggtaatattttagttgca
gagttaaggcttaaaatgcaaagaactatgcaaagccatgcttcggtatttagaactcaa
gaggtactagatgaaggagcaggaatgattagcgaaataagaagcggctataaagatata
aaaattaacgataaatctttaatttggaatagtgatttagtggaagccttagagctagat
aatctacttgatcaagctttagtaacggtatattcggcagctgcaagaaaagaaagcaga
ggagctcatgcacgtgaagattatcctgatcgtaatgatggggattggatgaagcatact
cttagctctatcgatgaagcaggtgaagtagttcttgattataaacctgtgactttaact
actttaaccgatgaagtaacagcagtcccgccggcgaagagagtgtactga

DBGET integrated database retrieval system