KEGG   Rhodothermus marinus DSM 4252: Rmar_0526Help
Entry
Rmar_0526         CDS       T01119                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr00564  Glycerophospholipid metabolism
rmr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rmr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rmar_0526
Enzymes [BR:rmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Rmar_0526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 NAD_binding_8 HI0933_like Pyr_redox_2 Thi4 GIDA Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ACY47428
UniProt: D0MEX8
LinkDB All DBs
Position
complement(595365..596996)
Genome map
AA seq 543 aa AA seqDB search
MQPLLHREAFLERLRKQEQWDVLIIGGGATGLGVALDAAARGFRTVLFEQHDFGKGTSSR
STKLIHGGVRYLREGDLGLVREALRERARLRHNAPHLVWPRLFVVPCYRWWERPFYGIGL
WLYDRLAGKGRLGLTRRLDAVETHALLPTLRQNHLRGGLAYPDGQFDDARLLVHLAWTAA
EHGAVVLNYMPVEALMGTRSHLEGVVVRDLDSGERFEVRGRVIVNATGVFADTVRRMDNP
NATPLIVPSQGVHLVLPRRFLPGEAALLIPRTDDGRVLFVIPWHGQVLLGTTDEPVPNPE
LEPLPTEEEITYLLTHAGRYLEPAPTRADIRAVFAGLRPLVQRGGMQEDTAHLSREHVLL
VSRRGLVTVTGGKWTTYRLMAEETVDRALEVGGLPHRTSPTATLRLHGATRHVNVADPWH
VYGTDARHLRRLMEAEPELAAPLHPRLPYRMVEVVWAARYEMARTVEDVLARRTRALFLD
AAAALEAAPAVARRLAAELGRDSAWVNAQLRDFVALVRRYVPDLHTHDPNDTSRSEQTAP
RRD
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgcaacctcttctgcatcgagaagcttttctggagcgcctgcgcaagcaagaacagtgg
gatgtgctcattattggaggaggggctacggggctgggagtggcgctggatgcagccgcc
cgaggctttcgtacggtgcttttcgagcaacacgacttcggcaaaggcacttcgagccgg
agcacgaagctcatccacggcggcgtgcgctacctgcgtgagggcgatctggggctggtg
cgcgaggcgctccgtgaacgtgcccggctccgccacaatgcgccgcacctggtctggccg
cgcctgttcgtggtgccctgctaccgctggtgggagcggcccttctacggcatcggactc
tggctctacgatcgtctggccggcaaaggccgactggggctgactcgccgcctcgacgcc
gtcgagacgcatgccctgctgccaacgcttcggcaaaatcatctgcggggcggcctggcc
taccccgacggtcagttcgacgacgcccggctgctagtgcatctggcctggacggccgcc
gagcacggtgccgtcgtgctcaactacatgcccgtcgaggcgctgatgggcacgcggtcg
cacctggaaggcgtcgtcgtgcgcgatctggattcgggcgagcgcttcgaagtgcgggga
cgtgtgatcgtcaacgcaacgggcgtcttcgccgacaccgtgcgccgtatggacaacccg
aacgccaccccgctcatcgtacccagccagggcgtacatctggtcctgccccgacgcttt
ctgccgggcgaagcggccctgctcattccccgcaccgacgacggccgcgtgctgttcgtg
atcccctggcacggacaggtgctgctgggcaccaccgacgagccggtgccgaatcccgag
ctggagcccctgcccaccgaggaggaaatcacctacctgctgacgcacgccggccgctac
ctggagccggctcccacccgagccgacatccgcgccgtctttgccggactccggccgctg
gtacagcgcggcgggatgcaggaagacacggcccatctatcgcgtgaacatgtgcttctg
gtctcccgccgagggctggtgaccgtcacgggtgggaagtggaccacctaccggctcatg
gccgaggagacggtggaccgggcgctggaggtgggcggtctgccgcaccgcacttcgccc
accgccacgctacgcctgcacggtgccacgcggcacgtcaatgtggccgatccatggcac
gtctacggcaccgacgcccggcacctgcgccgactcatggaagccgaacccgaactggcg
gctccgctgcatccccggctgccctatcgcatggtcgaagtcgtctgggctgcgcgctac
gaaatggcccgcactgtcgaagacgtgctggcccggcgcacgcgggcgctgtttctggac
gcagccgccgcgctcgaagcggcgccggccgtggcccgtcggctcgccgccgaactggga
cgcgacagcgcctgggtaaacgcgcagcttcgggacttcgtcgcactggttcgccgctac
gtgcccgaccttcacacccacgacccgaacgacacatcgcgttctgagcaaacggcaccg
cgccgggactga

DBGET integrated database retrieval system