KEGG   Rhodothermus marinus DSM 4252: Rmar_1200Help
Entry
Rmar_1200         CDS       T01119                                 

Definition
(GenBank) ribonuclease R
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rmr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Rmar_1200
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rmr03019]
    Rmar_1200
   03016 Transfer RNA biogenesis [BR:rmr03016]
    Rmar_1200
Enzymes [BR:rmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     Rmar_1200
Messenger RNA biogenesis [BR:rmr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     Rmar_1200
Transfer RNA biogenesis [BR:rmr03016]
 Prokaryotic type
  tRNA degradation factors
   Rmar_1200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB CSD2 S1 OB_Dis3 RNase_II_C_S1 Rho_RNA_bind
Motif
Other DBs
NCBI-ProteinID: ACY48090
UniProt: D0MHY2
LinkDB All DBs
Position
complement(1404002..1406257)
Genome map
AA seq 751 aa AA seqDB search
MARRKKSTQKKTKTARKKRLPTRPQIRRAILSLLRNNAHKAFRPKELAKLLDLRDYEAYQ
RFWEVLSELEHQHLVARVKGGRYTYERRPYRVEGILRVHPQGYGFVEIEGQEDEDIYISE
AHMGTALDGDRVLVGLAAPARGDRRREGEVLKVLERRRKQAVGTFYPRGAYAFVVPDDPR
LTRDIYVPREAFNGARAGDKVVVSIDRFDDPKASPEGRVLEVLGPASDPRVQVLALALSK
DVRTGFPEAALKEAERIPDTIPEREYRRRLDLRDRAVFTIDPSDAKDFDDALHLRRLPNG
HIEVGVHIADVSYYVRPGSALDEEAYQRGTSVYLVDRVIPMLPEKLSNQVCSLRPGEDKL
TYSVLMELTPSARVVRYQIRETVIHSRQRFTYEEAQAIIDGADHPLAEPVRLAHELAQKL
RKARMEAGAIDFDLPEVKVELDEAGNPIRIYRKERLAAHQLIEEFMLLANRLVAETIGKR
TEAPPFVYRIHDRPDAEKIRQLAQYVRVFGYHLELTEDGTVSSKALNELLQHVKGTPEEP
VIEEAALRAMAKARYSTQNIGHYGLAFDFYTHFTSPIRRYPDLMVHRLLKQYLKKAEKAP
VVDADELEARCRHCSERERAAEEAERDSVRFKQVQYMQQHVGERFRGVVSSVTNFGVFVE
LEDVLVEGLVHVRDMGDDYYEYDERRYTLRGMYSGKRYRPGDVVEVVVVRADPATRQIDL
RFVEPATDGEAPTPRRRRRRRKRAQAPGAGR
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
ttggcacgccgtaagaaatccacgcagaagaaaacaaaaacggcccgaaagaaacgcctg
cccactcgtccgcagatccggcgggcaatcctctcgcttttgcgcaacaatgcgcataag
gcgtttcggccgaaagaactggccaagcttttagatctccgcgattacgaggcctatcag
cgcttctgggaggtcctttcagagctggagcatcagcacctggtcgcccgcgtcaaggga
ggccgctacacctacgagcgccggccctatcgcgtggagggcatcctgcgcgtgcatccg
cagggctacggctttgtggagatcgaaggccaggaagacgaagacatctacatcagcgaa
gcgcacatgggcacggcgctcgacggcgaccgcgtgctggtgggcctggccgccccggcc
cgtggcgaccgccgccgggagggcgaggtgctcaaagtcctggaacgccgccggaagcag
gccgtcgggacgttctacccgcgcggcgcctatgccttcgtggtgcccgacgatccgcgc
ctgacgcgcgacatctacgtgccccgcgaggccttcaacggcgcccgcgccggcgacaag
gtggtggtctccatcgaccgcttcgacgatcccaaagcctcgcccgaagggcgcgtgctc
gaagtgctcggtccggccagcgatccgcgcgttcaggtgctggcgctggcgctcagcaag
gacgtgcgcaccggcttccccgaggccgcgctcaaagaagccgagcgcatccccgacacc
attcccgagcgcgaataccgtcgccggctggacctgcgcgaccgcgcggtctttacgatc
gacccctccgacgccaaggacttcgacgacgcgctgcacctgcggcgcctgcccaacggc
cacatcgaagtcggcgtccatatcgcagacgtcagctactacgtgcgacccggctccgcc
ctcgacgaagaagcctaccagcgcggcacgagcgtctatctcgtggatcgcgtaatcccc
atgcttcccgaaaaactctccaaccaggtctgctcgctgcggccgggggaggacaagctg
acctattcggtgctcatggagttgacgccctcggcccgggtcgtgcgctatcagatccgt
gagaccgtcatccactcgcgccagcgtttcacctacgaggaagcccaggccatcatcgac
ggcgccgatcatccgctggccgagccggtacgcctggcccacgaactggcccagaagctc
cgcaaagcccgcatggaagccggggccatcgacttcgatctacctgaagtaaaagttgaa
ctggacgaggccggcaacccgatccgtatctaccgcaaagagcggctggcggcccatcag
ctcatcgaggaattcatgctgctggccaatcggctggtggccgaaacgatcggcaaacgg
accgaagcaccgcctttcgtctaccgcattcacgaccggcccgacgccgagaaaatccgc
cagctggcgcagtacgtgcgcgtcttcggctatcatctggagctgaccgaagacggcacc
gtctcctcgaaagcgctcaacgagctgctccagcacgtgaagggcacgcccgaagagccg
gtcatcgaggaagcggccctgcgggccatggccaaagcccgctactcgacgcagaacatc
ggccattacgggctggcgttcgatttctacacgcacttcaccagccccatccggcgctat
ccggacctgatggtgcatcgcctgctcaagcaatacctgaagaaggcggaaaaagccccg
gtcgtcgacgccgacgagctggaggcccgttgccggcactgctccgagcgtgagcgggcc
gccgaagaggccgagcgcgactcggtccgcttcaagcaggtgcagtacatgcagcagcac
gtgggcgagcgcttccggggcgtggtcagcagcgtgacgaacttcggcgtgttcgtcgaa
ctcgaagacgtgctcgtcgagggcctggtgcacgtgcgcgacatgggcgacgactactac
gagtacgacgagcggcgttacacgctgcgcggcatgtactccggcaaacggtaccggccg
ggcgacgtggtcgaggtggtggtcgtgcgggccgatccggccacgcgtcagatcgatctg
cgctttgtggagcctgcaaccgacggcgaagcgcctacgccgcgtcgtcgccgtcgtcgg
cgaaaacgcgcgcaagcgcccggcgctgggcgctga

DBGET integrated database retrieval system