KEGG   Rhodothermus marinus DSM 4252: Rmar_1610Help
Entry
Rmar_1610         CDS       T01119                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Brite
Enzymes [BR:rmr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Rmar_1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ACY48496
UniProt: D0MJ38
LinkDB All DBs
Position
complement(1865989..1866543)
Genome map
AA seq 184 aa AA seqDB search
MRRESVLFTLALLWAACQQPAPPPAETPAAPEISRAVAVLHPTEGNQVEGVVHFTRTAEG
IRIEATVSGLTPGRHGFHIHEWGDCSAPDATSAGGHFNPTDQPHGAPDSPARHVGDLGNL
EAGEDGMASYSRVDTVVAFSGPRSIIGRAVIVHAAEDDLTSQPTGNAGGRLACGVIGIAA
PATE
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgagaaagtgtgctctttacccttgcgttgctctgggcggcctgccagcaaccg
gcgccccctccggccgagacgcccgccgcgccggaaatttcccgggccgtcgccgtgttg
caccccacggagggcaatcaggtggagggtgtggtgcattttacccggacggccgagggc
attcgcatcgaggcaaccgtgtcgggcctgacgcccggccgacacggctttcacatccac
gagtggggcgactgcagcgcgccggatgctacgtcggcgggcggacacttcaaccccacc
gatcagccgcacggcgcgcctgatagcccggcgcggcatgtgggcgacctgggcaatctg
gaagccggcgaagacgggatggccagctacagccgcgtcgatacggtggtggccttcagc
ggtccgcgttccatcatcggtcgtgccgtgatcgtgcacgcggccgaagacgacctgacc
tcgcagcccacgggtaatgcgggcggccggctggcctgtggcgtgatcggtatcgccgcg
ccggccacggaataa

DBGET integrated database retrieval system