KEGG   Rhodothermus marinus DSM 4252: Rmar_1619Help
Entry
Rmar_1619         CDS       T01119                                 

Definition
(GenBank) histidyl-tRNA synthetase
  KO
K01892  histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rmr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rmar_1619
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rmr01007]
    Rmar_1619
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rmr03016]
    Rmar_1619
Enzymes [BR:rmr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     Rmar_1619
Amino acid related enzymes [BR:rmr01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Rmar_1619
Transfer RNA biogenesis [BR:rmr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Rmar_1619
 Prokaryotic type
    Rmar_1619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2b HGTP_anticodon tRNA-synt_2 tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: ACY48505
UniProt: D0MJ47
LinkDB All DBs
Position
complement(1874007..1875317)
Genome map
AA seq 436 aa AA seqDB search
MSLEPTFRNIRGTFDILPQDGRSEGAHDMPSRAWQHVEQVVREVLERFNFREIRTPILEP
TELIARGVGQLTDIVSKEMFAFRRGDTNYVLRPEVTAPVMRAYLQHRLDQQGAVQKLYYI
GPCFRAENPQKGRYRQFHQFGVELIGAETPEADAEVIAAMMAVYEAFGLKNLRLRINTLG
DAESRPRYREALRAYLQPLADRLTPTSRQRLETNPLRILDTKDERERRLLEGAPRIIDFV
DEKGRAHYEAVKAHLQALGIAFEEDPFLVRGLDYYTHTTFELESPDLGAQSALAGGGRYD
LLAMDLGHDAPVPAVGFAAGIERLFIALQAQGYAFPEEPPLDAYLVSLGEEAMRRALVEA
QALRRAGLRVDLDLKGRSMKAQMREANRQQARYAVIMGERELAEGRAVVRDMQSGQQQEV
PLDELADFLKGAVRVS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagtctggaaccgacgtttcgcaacatacggggaacgttcgacatcctgccccaggac
ggccgcagcgaaggggcacacgacatgcccagccgggcctggcagcacgtcgaacaggtc
gtccgggaggtgctcgagcgcttcaacttccgggagattcgcacgccgattctggaaccc
accgagctgatcgcccggggggtcggccagctgaccgacatcgtcagcaaggagatgttc
gccttccggcggggcgacaccaactacgtgctgcgccccgaggtgacggcgccggtcatg
cgggcctatctgcagcaccggctcgatcagcagggcgccgtgcagaagctctactacatc
ggcccctgcttccgggccgaaaatccccagaagggccggtaccggcagttccatcagttc
ggcgtcgagctgatcggcgccgagacgcccgaggccgatgccgaggtgatcgcggccatg
atggccgtttacgaggcgttcggcctgaaaaatctgcggctgcgcatcaacacgctgggc
gacgccgaaagccgaccccgctaccgggaagcgctgcgggcctacctgcagccgctggcc
gatcggctcacgcccaccagccggcagcgcctcgagacgaacccgctccgcattctcgat
acgaaagacgagcgcgaacggcgcctgctcgaaggcgcgccccggatcatcgacttcgtg
gacgaaaaaggccgggcgcattacgaagcggtcaaagcgcacctgcaggcgctgggtatc
gccttcgaggaagatcccttcctggtgcgggggctggactattacacgcacacgacgttc
gagctggagagtccggacctgggggcgcagagtgcgctggctggcggcggacgctacgac
ctgctggccatggatctggggcacgacgctccggtaccggccgtgggctttgcggcgggc
atcgagcggctgttcatcgcgttgcaggcgcagggatacgctttccccgaagagccgccg
ctggacgcctacctggtctcgctgggtgaggaagccatgcgccgggcgctggtcgaagcg
caggcgctgcgccgggccggcctgcgcgtggacctggacctgaaaggccgttcgatgaag
gcgcagatgcgcgaggccaaccgccagcaggcccgctatgccgtcatcatgggcgagcgc
gaactggccgaagggcgagccgtcgtgcgcgacatgcaatccggccagcaacaggaagtg
ccgctggacgagttggccgactttctgaagggagccgtgcgtgtttcataa

DBGET integrated database retrieval system