KEGG   Rhodothermus marinus DSM 4252: Rmar_1661Help
Entry
Rmar_1661         CDS       T01119                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr00620  Pyruvate metabolism
rmr00680  Methane metabolism
rmr01100  Metabolic pathways
rmr01120  Microbial metabolism in diverse environments
rmr01200  Carbon metabolism
Module
rmr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rmar_1661
  09102 Energy metabolism
   00680 Methane metabolism
    Rmar_1661
Enzymes [BR:rmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Rmar_1661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ACY48547
UniProt: D0MJ89
LinkDB All DBs
Position
1924220..1927036
Genome map
AA seq 938 aa AA seqDB search
MSVLPPLQIEIEGTGISRPLSEHVNLLGGLLGQVIQEMAGPEMLELVETLRRLCKQAAQE
NRPELREQAYTRIHSATYDELLWLLRAYTAFFHLVNQAEQQEIIRINRERAQQSTPEHPR
PESIDEAILALKQQGRTLDDVLALLERLDIQPTLTAHPTEARRRSILYKQQHIARLLSQQ
RRCRLTPEEQEALLVDLHNQITLLLGTAEVREERPTVRDEVEQGLYFIQSTIWEAVPRIH
EDVRRALRRYYGTDADFRPFLRYRSWIGSDRDGNPYVTPEITRWTALTQRRLVLQRYMEE
LRQLRRRLSLSDRYVPPPEELRRSLARDAREVSLPPHVLRQFRHESFRLKISYIMGRLHG
LLQALDDPTQPAPDYDADAFVEDLRLLQRCLEACGLERIARHDQLSRLLVLVQTFGFHLV
TLDVRQHSSVHEAAVAELLRLAGVENDYRALPESRRQELLAEELSNPRPLLPPGARVSEA
TRQVLETFAAIRELVQLDPRLVGSYIVSMTHTVSDLLEPMLLAKEVGLWHYERDPRTGKP
GHVRCPIDFVPLFETIEDLEAAASRMEAILSHPVYRMQVAARGGFQEIMLGYSDSTKDGG
YWMANWALHRAQEQLAEVCLRHGVDFRLFHGRGGTVGRGGGRANQAILAMPPVVHNGRIR
FTEQGEVISFRYALPEIAHRHLEQIVNAMLRVVGLPAASGTDGTDPATRNRLMDELATRS
MRAYRRLIDAPDFWSWYTRITPIDQISRLPIASRPVSRSSAREVDFESLRAIPWVFAWTQ
VRYLIPGWFGIGQALDELLQTSPEHLETLRTWYRSWPFFRTVLQNAQREMVRARLEIAAY
YDRLLGDGPTAFHQMIEEDYHRARTAILRITDQEELLDHDPIIRKSVQLRNPYTDVLNLV
QLELMRRYRQAPEADREPLRRALFLSINGIAAAMQSTG
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcttccccctttgcagatcgaaatcgaaggcaccggcatttcccgaccgctc
agcgaacacgtgaacctgcttggcggcctgctgggacaggtcattcaggaaatggccggt
cccgaaatgctggagctggtcgagacgctgcggcgcctgtgcaagcaggcggcccaagaa
aaccgtcccgagctccgggagcaggcctacacgcgcatccacagcgccacctacgacgag
ctgctctggctgctgcgcgcctacacggcctttttccacctggtcaaccaggccgagcaa
caggagatcatccggatcaaccgggaacgggcacagcagagtacgcccgaacacccgcgt
ccggagtcgatcgacgaggccatcctggccctcaagcagcagggccggacgctcgacgac
gtgctggcgctgctggagcggctggacattcagcccacgctgaccgcccatcccaccgaa
gcacgccgccgcagcatcctctacaagcagcagcacatcgcccggctgctttcgcagcaa
cgccgctgccggctcacgcccgaggagcaggaagccctgctggtggacctgcacaaccag
atcacgctgctgctgggcacggccgaggtgcgcgaggaacgccccaccgttcgcgacgaa
gtcgaacagggcctgtactttatccagagtacgatctgggaggcagtgccccgcattcat
gaagacgtgcgccgggcgctgcgccgctactacggcaccgacgccgacttccggccgttt
ctgcgctaccgctcctggatcgggagcgaccgcgacggcaacccttacgtcacgccggaa
atcacgcgctggacggccctgacgcagcgacggctggtgctccagcgctacatggaggag
ctgcgccagctccgacgccggctgagtctttcggatcgctacgtgccgcccccggaggag
ctgcgccgctcgctggcccgcgacgcccgggaggtgtcgctcccgccccacgtgcttcgc
cagttccgacacgagtcgttccggctgaagatctcctacatcatggggcggctgcacggg
ctgctccaggcgctggacgatccgacgcagcctgcgcccgactacgacgccgatgccttc
gtcgaagacctgcggctgctgcagcgctgcctggaagcctgcggtctggagcgcattgcg
cgtcacgatcagctctcccgcctgctggtgctggtccagacgttcggctttcatctggtc
acgctcgacgtgcgccagcacagcagcgtgcatgaagccgccgtggccgagctgctcagg
ctggccggggtcgagaacgactaccgggccctgcccgagtcgcgccgccaggagctgctg
gccgaggagctgagcaatccgcggccgctgctgccgccgggggcccgggtgtcggaagcc
acgcggcaggtgctggagaccttcgcggccatccgcgagctggtgcagctcgaccctcgc
ctcgtgggcagctacatcgtgagcatgacgcacaccgtcagcgacctgctcgagcccatg
ctgctggccaaagaagtcgggctctggcactacgagcgcgacccccgcaccggcaagccg
ggccacgtgcgctgccccatcgattttgtgccgcttttcgagacgatcgaagacctggag
gcggcggccagccgcatggaagccatcctgagccatcccgtctaccggatgcaggtggct
gcccgcggcggctttcaggaaatcatgctgggctactccgacagcacgaaagacggtggc
tactggatggccaactgggcgctgcatcgggcccaggagcagctggccgaagtatgtctt
cgccatggcgtggacttccggctgtttcacgggcgcggcggtactgtgggacgtgggggc
ggccgcgccaaccaggccatcctggccatgccgccggtggtccataacggccgcattcgc
ttcaccgagcagggcgaggtgatctcgttccgctatgccctgcccgagatcgcccatcgc
cacctggagcagatcgtcaatgccatgctccgcgtggtcggcctcccggccgcttccggc
accgatggcaccgatccggccacgcgcaaccgcctgatggacgagctggccacgcgctcc
atgcgggcttaccggcgcctgatcgatgcgcctgacttctggtcgtggtacacgcgcatc
actccgatcgaccagatcagccgcctgcccatcgcctcgcggccggtctcgcgcagcagc
gcccgtgaggtcgacttcgaaagcctgcgggccatcccctgggtcttcgcctggacccag
gtccgctacctgattccgggctggttcgggatcggccaggccctcgacgagttgctccag
acgtcgcccgagcatctggagacgcttcgcacctggtatcgatcctggccgtttttccgc
accgtgctgcagaacgcccagcgcgagatggtgcgcgcccgcctggaaattgccgcctac
tatgaccggctactgggcgacggcccgacggcattccatcagatgatcgaggaagactat
catcgagcccggacggccatcctgcgcatcaccgatcaggaggagttgctcgaccacgat
ccgatcatccgcaaatccgtgcagctccgcaacccgtacaccgatgtgctgaacctggtg
cagctcgagctgatgcggcgctatcgccaggcgcccgaggccgatcgggagccgctccgg
cgcgctctgttcctgagcatcaacgggatcgccgccgccatgcagagcaccggatag

DBGET integrated database retrieval system