KEGG   Rhodothermus marinus DSM 4252: Rmar_2350Help
Entry
Rmar_2350         CDS       T01119                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rmr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rmar_2350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rmr01007]
    Rmar_2350
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rmr03016]
    Rmar_2350
   03029 Mitochondrial biogenesis [BR:rmr03029]
    Rmar_2350
Enzymes [BR:rmr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Rmar_2350
Amino acid related enzymes [BR:rmr01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Rmar_2350
Transfer RNA biogenesis [BR:rmr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Rmar_2350
 Prokaryotic type
   Other AARSs
    Rmar_2350
Mitochondrial biogenesis [BR:rmr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Rmar_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon GAD tRNA-synt_2d DUF4541 tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: ACY49228
UniProt: D0MEK0
LinkDB All DBs
Position
2721667..2723526
Genome map
AA seq 619 aa AA seqDB search
MSDQHGHTLGRDLHGPRTHTCGELRRAHVGQEVVLKGWVDTRRDLGGVIFIDLRDRYGLT
QIVFSPQDNETAYRLADRLRSEYVISVRGVVRERSPETVNPKLATGEVEVRAHDLIILNT
SEPLPFPVSAHEEKRTTTSEELRLKYRYLDLRRPELQRNLLLRHQVYLITRRYFDAHQFV
EVETPVLTKSTPEGARDFLVPSRLHPGKFYALPQSPQLYKQILMVAGLDRYFQIVKCFRD
EDLRADRQPEFTQIDVEMTFPTEEQIFELIEGLIQAIWRETLGVELPRPFPRMSYDEALR
RFGSDKPDTRFGLELQEIGEVFRGSGFRVFESVLEQGGEIVALVVPGMGDQGRGYMDRLD
KDVVRKQIGAGGLVYFKLPSDGGPIYSSVKEHVLPSAYVQRAVAKLGARAGDLVLLLAGP
RPQVYLQAGALRLHMARELNLVPPAGQAPWHFLWVTDFPLLEWDEEAGRYFAMHHPFTSP
HPDDLDLLETEPGRVRARAYDLVLNGNEIGGGSIRIHRQDIQRRMFRVLGIDEEEAERRF
GFLLTAFRYGAPPHGGIALGLDRIVMLLAGAGSLRDVIAFPKTQRGQELMSNAPDEVSPE
QLEELHIRVVLPETEASGS
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccagcacgggcacacgctcggccgtgatctgcacggcccgcgcacgcacacc
tgtggcgaactccgacgcgcgcacgtcggccaggaagtcgtgctcaaagggtgggtcgat
acgcggcgcgacctgggcggcgtcatcttcatcgacctgcgcgaccgctacgggcttacc
cagatcgtcttttctccacaggacaacgagacggcctatcgactggccgaccgtctgcgc
agcgagtacgtgatctcggtgcggggcgtggtgcgcgagcgctcgccggagaccgtcaac
cccaagctcgccaccggtgaagtcgaggtccgcgcccatgacctgatcattctcaacacc
tccgagccgctgccgtttccggtttcggcccacgaggaaaagcgcaccacgaccagcgaa
gagctgcgcctgaagtaccgctaccttgacctgaggcggcccgaactgcagcgcaacctg
ctgctgcgccaccaggtctatctgatcacccgacgctacttcgacgcgcatcagttcgtc
gaagtcgaaacgcccgtgctgaccaaatcgacaccggaaggggcccgtgactttctggtt
cccagccgcctgcacccgggcaagttctacgcgctgccccagtcgccgcagctctacaaa
cagattctgatggtggcggggctggatcgctacttccagatcgtcaaatgtttccgcgat
gaggatctccgcgccgatcgccagccggaattcacccagatcgatgtggagatgaccttc
cccaccgaggagcagatttttgaactcatcgaagggcttatccaggcgatctggcgcgag
acgctgggcgtcgaactgccgcgccccttcccgcgcatgtcctacgacgaggcgctgcgg
cgcttcggctccgacaagccggacacgcgctttggcctcgaattgcaggaaatcggcgag
gtctttcgcggctccggcttccgggtcttcgaaagcgttctggagcagggcggcgaaatc
gtggcgctggtggtgccgggcatgggcgaccagggccggggctacatggatcgcctggac
aaagacgtcgtgcgcaagcagatcggcgccggcggactggtctacttcaagctgccttcc
gacggcggcccgatctattcctcggtcaaggagcacgtgctcccgtcggcgtacgtccag
cgcgccgtggcgaagctcggcgcccgggcgggcgacctggtgctgctgctggccggtccc
cggccgcaggtgtacctgcaggccggtgcgttgcgcctgcacatggcccgcgagttgaat
ctggtcccgccggccggccaggcgccctggcacttcctgtgggtcaccgactttccgctg
ctggaatgggacgaagaggccgggcgctacttcgccatgcaccatccgttcacctcgccg
cacccggacgatctggacctgctggaaaccgagccgggccgcgtgcgcgcccgcgcctac
gacctggtgctgaacggcaacgaaattggcggcggctcgatccgtatccaccggcaggac
atccagcgccggatgtttcgtgtgctgggcatcgacgaggaagaagccgagcggcgcttc
ggtttcctgctgaccgcctttcgctacggggccccgccacacggcggcatcgcgctgggc
ctggatcgcatcgtgatgctgctggccggtgccggctcgctccgcgacgtcatcgccttc
ccgaagacgcagcgcgggcaggaactgatgtcgaacgcgcccgacgaggtctcgcccgag
cagctcgaagagctgcacattcgcgtggtgctgccggagacggaagcctcaggctcctga

DBGET integrated database retrieval system